DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and slc25a20l

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_031746643.1 Gene:slc25a20l / 779503 XenbaseID:XB-GENE-5944561 Length:303 Species:Xenopus tropicalis


Alignment Length:307 Identity:99/307 - (32%)
Similarity:158/307 - (51%) Gaps:42/307 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SETFSPKMVVDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDP----RNPKYKGTFHCFRTIVQRDK 93
            |:|.:...|.:.:||.:||...:|.|.|.||:||:|||...    :.|.|..|.|||..|:.|:.
 Frog     5 SKTQTAPPVKNVIAGGIGGMCLILAGQPLDTIKVNLQTQPSPALGQQPLYNSTLHCFSKIIAREG 69

  Fly    94 FIGLYRGISSPMGGIGLVNAIVFGVYG---NVQRLSNDPNSLTSH---FFAGSIAGVAQGFVCAP 152
            ..|||||:.:|:..:..:.:|.|..:|   ::|:.|  |:|:...   |.||.:||::...:.||
 Frog    70 IRGLYRGMGAPLAVVTPIMSITFVGFGLGKSLQQTS--PDSILRSWQVFVAGMLAGLSSTVLMAP 132

  Fly   153 MELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYL- 216
            .|..|..||:.: |.....|.||:.|.:.:.:..||||.::|...|::||:|....||:|:|:: 
 Frog   133 GERIKCLLQVQS-VTLKKTFQGPLDCAQTLYRELGIRGLYRGTLLTLIRDVPSTGVYFMSYEWMK 196

  Fly   217 ------------MRQVETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFID 269
                        :|..|      .|:|||.|||.:||...|.||:|:..|.   .....|...::
 Frog   197 EKMRGERSSARELRATE------ILLAGGVAGMCNWLVAIPADVLKSRFQT---APENHYKNILE 252

  Fly   270 CAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACFF-------VVSWVL 309
            ...:...:|||...:||..:.::||||.|||||.       .::|::
 Frog   253 VLREVLHSEGPCGLYRGFTAAMLRAFPANAACFLGFEASMSFLNWLI 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 33/95 (35%)
PTZ00169 41..295 CDD:240302 88/276 (32%)
Mito_carr 128..218 CDD:278578 31/105 (30%)
Mito_carr 221..304 CDD:278578 30/89 (34%)
slc25a20lXP_031746643.1 Mito_carr 8..105 CDD:395101 33/96 (34%)
Mito_carr 110..201 CDD:395101 29/91 (32%)
Mito_carr 215..295 CDD:395101 29/82 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.