DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and slc25a47a

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001038779.1 Gene:slc25a47a / 724009 ZFINID:ZDB-GENE-060616-266 Length:294 Species:Danio rerio


Alignment Length:279 Identity:99/279 - (35%)
Similarity:149/279 - (53%) Gaps:21/279 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPMGG 107
            ||:||..|||.||.||:|.|||||.:||    ..::.|.:.|....::::...|.::|:..|:..
Zfish     5 DFLAGSFGGACGVAVGYPLDTVKVRIQT----QKQFTGIWQCIVLTIRKEGVHGFFKGMFLPITT 65

  Fly   108 IGLVNAIVFGVYGN-VQRLS---NDPNSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQLSTQVDS 168
            |.:.:::|||.|.| :|.||   ...|:....|.:|...||||..|.:|.::.|.|||..|:...
Zfish    66 ISMTSSVVFGTYRNCLQALSYIRKAENTKLDVFMSGLAGGVAQVSVMSPGDIVKVRLQCQTESRH 130

  Fly   169 GI--------KFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQV----- 220
            .:        |::||||||..|.:.:|:.|.::|.....|||.|.||:||:::..|..::     
Zfish   131 SVNPKYSVKPKYSGPIHCLLSICREQGLSGLYRGALPLALRDGPSFATYFLTYHTLCARLTPDGQ 195

  Fly   221 ETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNEGPQYFFR 285
            :.|.....|::||.||||.|....|:||:|..:|.|.:....:|.|.:.|.....|.||...|||
Zfish   196 KEPEWTVVLLSGGVAGMSGWAVGTPMDVIKARLQMDGVRGQRRYRGLLHCLTVTTRTEGLGVFFR 260

  Fly   286 GLNSTLIRAFPMNAACFFV 304
            .|....:||||:|...|.|
Zfish   261 SLGINCLRAFPVNMVVFAV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 31/82 (38%)
PTZ00169 41..295 CDD:240302 93/268 (35%)
Mito_carr 128..218 CDD:278578 34/97 (35%)
Mito_carr 221..304 CDD:278578 31/82 (38%)
slc25a47aNP_001038779.1 Mito_carr 3..77 CDD:278578 28/75 (37%)
Solcar 1 4..83 30/81 (37%)
Solcar 2 95..189 33/93 (35%)
Mito_carr 98..183 CDD:278578 32/84 (38%)
Mito_carr 196..288 CDD:278578 32/84 (38%)
Solcar 3 198..286 32/82 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0762
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X353
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.