DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and MGC108450

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001015800.1 Gene:MGC108450 / 548517 -ID:- Length:301 Species:Xenopus tropicalis


Alignment Length:293 Identity:98/293 - (33%)
Similarity:144/293 - (49%) Gaps:40/293 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SPKMVVDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPK-YKGTFHCFRTIVQRDKFIGLYRG 100
            |.:..:|..||..||.|.||.|.||||.||.:||    .|. |:|...|.....::....|.|:|
 Frog     6 SIQAAIDLTAGAAGGTACVLTGQPFDTAKVKMQT----FPSLYRGLMDCAVKTYKQMGLTGFYKG 66

  Fly   101 ISSPMGGIGLVNAIVFGVYGNVQRL------------SNDPNSLTSHFFAGSIAGVAQGFVCAPM 153
            .|..:......|:::|..||..|:.            .||.::.|:..||.:.|.:|   :| |.
 Frog    67 TSPALLANISENSVLFMSYGFCQKAVRRIVGLDKNAELNDLHNATAGSFAAAFAALA---LC-PT 127

  Fly   154 ELAKTRLQ------LSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVS 212
            ||.|.|||      ||.:|..|......:  :|.|::|:|..|.:.||::|:||::||:..:|..
 Frog   128 ELVKCRLQAMHEMTLSGKVTVGQNTVWSV--VKSILRTDGPMGFYHGLSSTMLREVPGYFFFFGG 190

  Fly   213 FEYLMRQV--------ETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFID 269
            :| |.|..        :..|:...:::||..|:|.||..:|:|.||:.:|  .|....|..||:.
 Frog   191 YE-LSRSCFVTTGKTKDDLGIVPLIISGGVGGISLWLVVFPVDCVKSRIQ--VLSMTGKQAGFLS 252

  Fly   270 CAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACF 302
            ...:..||||....:.||..|||||||.|.|.|
 Frog   253 TFGRILRNEGVMALYSGLKPTLIRAFPANGALF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 31/88 (35%)
PTZ00169 41..295 CDD:240302 91/280 (33%)
Mito_carr 128..218 CDD:278578 33/95 (35%)
Mito_carr 221..304 CDD:278578 32/82 (39%)
MGC108450NP_001015800.1 Mito_carr 9..90 CDD:365909 29/84 (35%)
Mito_carr <125..195 CDD:365909 27/73 (37%)
Mito_carr 208..297 CDD:365909 32/80 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.