DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and CG5646

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_651568.1 Gene:CG5646 / 43311 FlyBaseID:FBgn0039525 Length:303 Species:Drosophila melanogaster


Alignment Length:303 Identity:108/303 - (35%)
Similarity:151/303 - (49%) Gaps:38/303 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFI-GLYRGISSPMG 106
            |||||..|||.||||.||.||:||..|..:      .......:.|..|:..: |.|||:..|..
  Fly     8 DFVAGCFGGACGVLVAHPLDTIKVWQQASN------SSVVTAIQQIYSRNNGVNGFYRGMFFPFI 66

  Fly   107 GIGLVNAIVFGVYGN-VQRLSNDPNS------LTSH--FFAGSIAGVAQGFVCAPMELAKTRLQL 162
            ..|.:|:::||:||| :::|....:|      |..|  |.|||:||..|.|:..||||.|.|||.
  Fly    67 STGAINSLLFGIYGNHLRQLRKVCHSDYQREQLEYHNMFLAGSVAGFVQSFIACPMELIKVRLQT 131

  Fly   163 STQVDS---GIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSF----EYL---- 216
            :|....   |.:.|. ....|.|:||:||.|.::||...:.||:..:..|.:::    :|:    
  Fly   132 ATYYSDYLYGQRRTA-FGTFKRILKTDGISGLYRGLLPMMCRDVLPYGIYMLAYRQGVDYMDRRD 195

  Fly   217 ---MRQVETPG----VAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKG 274
               .|:.::.|    :..|.:||..||:.||:...|.|||||.||||   .|.||.|...|....
  Fly   196 FVRRRRSQSDGSSVNLLVTTLAGAWAGVISWVCVIPFDVVKTLMQAD---ENHKYRGIFHCVRVQ 257

  Fly   275 FRNEGPQYFFRGLNSTLIRAFPMNAACFFVVSWVLDICNAKGG 317
            :|..|.:..|||....:.||.|.|||.|....:.|:.|....|
  Fly   258 YRAYGWRSIFRGSWMLVARAVPFNAATFLGYEYALEWCQRWNG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 33/83 (40%)
PTZ00169 41..295 CDD:240302 99/279 (35%)
Mito_carr 128..218 CDD:278578 35/111 (32%)
Mito_carr 221..304 CDD:278578 35/86 (41%)
CG5646NP_651568.1 Mito_carr 5..79 CDD:395101 30/76 (39%)
Mito_carr 97..191 CDD:395101 33/94 (35%)
Mito_carr 207..294 CDD:395101 35/89 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45624
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.