DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and CG4743

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:249 Identity:71/249 - (28%)
Similarity:106/249 - (42%) Gaps:43/249 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SEIGDIQLKATSETFSPKMVVDFVAGLLGGAAGVLVG---HPFDTVKVHLQTDDPRNPKYKGTFH 83
            |..|.:.:|........|.   |.|.:.||.||::|.   .|.||||..||::       .|.: 
  Fly     9 SAAGSVAIKMQEPVNKLKF---FHALVAGGVAGMVVDIALFPIDTVKTRLQSE-------LGFW- 62

  Fly    84 CFRTIVQRDKFIGLYRGISSPMGGIGLVNAIVFGVY-------GNVQRLSNDPNSLTSHFFAGSI 141
                  :...|.|:|:|::....|.....|:.|..|       .:|.:..:.|   ..|..|.|.
  Fly    63 ------RAGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDSP---YVHMAAASA 118

  Fly   142 AGVAQGFVCAPMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGI-RGAFKGLTATILRDIPG 205
            |.|....:..|:|:||.|    :|...|.|.:| :..|....:|||: ||.::|..:||:|:||.
  Fly   119 AEVLACLIRVPVEIAKQR----SQTLQGNKQSG-LQILLRAYRTEGLKRGLYRGFGSTIMREIPF 178

  Fly   206 FASYFVSFEYLMRQVETPGVAY------TLMAGGCAGMSSWLACYPIDVVKTHM 253
            ....|..:||...| .||...:      ..:.|..||..|.....|:|||||.:
  Fly   179 SLIQFPLWEYFKLQ-WTPLTGFDSTPFSVALCGAVAGGISAGLTTPLDVVKTRI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 25/98 (26%)
PTZ00169 41..295 CDD:240302 67/230 (29%)
Mito_carr 128..218 CDD:278578 30/90 (33%)
Mito_carr 221..304 CDD:278578 12/39 (31%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 24/92 (26%)
PTZ00168 25..281 CDD:185494 68/233 (29%)
Mito_carr 199..291 CDD:278578 10/33 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441395
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.