DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and CG4743

DIOPT Version :10

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:249 Identity:71/249 - (28%)
Similarity:106/249 - (42%) Gaps:43/249 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SEIGDIQLKATSETFSPKMVVDFVAGLLGGAAGVLVG---HPFDTVKVHLQTDDPRNPKYKGTFH 83
            |..|.:.:|........|.   |.|.:.||.||::|.   .|.||||..||::       .|.: 
  Fly     9 SAAGSVAIKMQEPVNKLKF---FHALVAGGVAGMVVDIALFPIDTVKTRLQSE-------LGFW- 62

  Fly    84 CFRTIVQRDKFIGLYRGISSPMGGIGLVNAIVFGVY-------GNVQRLSNDPNSLTSHFFAGSI 141
                  :...|.|:|:|::....|.....|:.|..|       .:|.:..:.|   ..|..|.|.
  Fly    63 ------RAGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDSP---YVHMAAASA 118

  Fly   142 AGVAQGFVCAPMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGI-RGAFKGLTATILRDIPG 205
            |.|....:..|:|:||.|    :|...|.|.:| :..|....:|||: ||.::|..:||:|:||.
  Fly   119 AEVLACLIRVPVEIAKQR----SQTLQGNKQSG-LQILLRAYRTEGLKRGLYRGFGSTIMREIPF 178

  Fly   206 FASYFVSFEYLMRQVETPGVAY------TLMAGGCAGMSSWLACYPIDVVKTHM 253
            ....|..:||...| .||...:      ..:.|..||..|.....|:|||||.:
  Fly   179 SLIQFPLWEYFKLQ-WTPLTGFDSTPFSVALCGAVAGGISAGLTTPLDVVKTRI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:395101 25/98 (26%)
Mito_carr 128..218 CDD:395101 30/90 (33%)
Mito_carr 221..304 CDD:395101 12/39 (31%)
CG4743NP_651415.1 PTZ00168 25..281 CDD:185494 68/233 (29%)

Return to query results.
Submit another query.