DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and Dic1

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster


Alignment Length:283 Identity:72/283 - (25%)
Similarity:106/283 - (37%) Gaps:59/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GGAAGV---LVGHPFDTVKVHLQTDD---------PRNPKYKGTFHCFRTIVQRDKFIGLYRGIS 102
            ||.|.|   :|.||.|.:||.|||..         |:..:.:|.             :..|.|:|
  Fly    13 GGLASVGAAMVTHPLDLIKVTLQTQQGHLSVAQLIPKLAREQGV-------------LVFYNGLS 64

  Fly   103 SPMGGIGLVNAIVFGVYGNVQRLSNDPNSLTSHFFAGSIA-----GVAQGFVCAPMELAKTRLQL 162
            :.:......:...||||...::..|..:      |.|.:|     |:..|.|..|.::...|:|.
  Fly    65 ASVLRQLTYSTARFGVYEAGKKYVNTDS------FGGKVALAGASGLVGGIVGTPADMVNVRMQN 123

  Fly   163 STQV--DSGIKFTGPIHCLKYIVKTEGIRGAFKGLTAT----ILRDIPGFASYFVSFEYLMRQVE 221
            ..::  .....:......|..:.:.||.:..|.|.||.    ||..|...|.|..:..||:   .
  Fly   124 DVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLL---A 185

  Fly   222 TPGVAYTLM----AGGCAGMSSWLACYPIDVVKTHMQADALGANAK---YNGFIDCAMKGFRNEG 279
            ||.....|:    |...||..:.....|:||:||.      ..|||   :||..| .:|.....|
  Fly   186 TPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTR------SMNAKPGEFNGLWD-IVKHTAKLG 243

  Fly   280 PQYFFRGLNSTLIRAFPMNAACF 302
            |..||:|.....:|..|.....|
  Fly   244 PLGFFKGYVPAFVRLGPHTIITF 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 22/86 (26%)
PTZ00169 41..295 CDD:240302 70/274 (26%)
Mito_carr 128..218 CDD:278578 23/100 (23%)
Mito_carr 221..304 CDD:278578 26/89 (29%)
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 23/91 (25%)
PTZ00169 13..273 CDD:240302 72/283 (25%)
Mito_carr 89..184 CDD:278578 23/100 (23%)
Mito_carr 189..278 CDD:278578 24/85 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.