DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and GC2

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:279 Identity:83/279 - (29%)
Similarity:129/279 - (46%) Gaps:47/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PKMVVDFVAGLLGGAAGVLVGHPFDTVKVHL--QTDDPRNPK-YKGTFHCFRTIVQRDKFIGLYR 99
            ||::...|||::    ||...:|.|.||..|  ||..|...: |.....|||..:..:.:.|:||
  Fly    22 PKIINGGVAGII----GVACVYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEGYFGMYR 82

  Fly   100 GISSPMGGIGLVNAIVFGVYGNVQRLSND-------------PNSLTSHFFAGSIAGVAQGFVCA 151
            |        ..||.::......::..:||             |  |:....||.:||:.|..|..
  Fly    83 G--------SAVNIVLITPEKAIKLTANDFFRYHLASDDGVIP--LSRATLAGGLAGLFQIVVTT 137

  Fly   152 PMELAKTRLQLSTQVDSG-------IKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASY 209
            ||||.|.::|.:.:|.:.       :|....:...|.:::..||.|.:||:.||.:|||.....|
  Fly   138 PMELLKIQMQDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVY 202

  Fly   210 FVSFEYL----MRQVETPGVA---YTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGF 267
            |....::    .|:.:..|.|   ::|:||..:||:|.....|.|||||.:|||   ...|:.|.
  Fly   203 FPLMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQAD---GEKKFKGI 264

  Fly   268 IDCAMKGFRNEGPQYFFRG 286
            :||..:..:.||...||:|
  Fly   265 MDCVNRTLKEEGISAFFKG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 25/89 (28%)
PTZ00169 41..295 CDD:240302 81/276 (29%)
Mito_carr 128..218 CDD:278578 30/113 (27%)
Mito_carr 221..304 CDD:278578 26/69 (38%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 83/279 (30%)
Mito_carr 16..106 CDD:278578 27/95 (28%)
Mito_carr 123..203 CDD:278578 25/79 (32%)
Mito_carr 228..302 CDD:278578 24/59 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441404
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0762
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.