DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and Tpc1

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster


Alignment Length:304 Identity:70/304 - (23%)
Similarity:125/304 - (41%) Gaps:56/304 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VAGLLGGAAGVLVGHPFDTVKVHLQTD-DP--RN----------PKYKGTFHCFRTIVQRDKFIG 96
            :||.|..|.......|.|.:|:..|.. :|  :|          .||.......:||.:.:..:.
  Fly    33 LAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLA 97

  Fly    97 LYRG-----ISSPMGGIGLVNAIVFGVYGNVQRLSNDPNSLTSH-----FFAGSIAGVAQGFVCA 151
            .::|     :.|.|.||     ..|..|..:..::...:.|..|     |..|:.||.|...:..
  Fly    98 FWKGHNPAQVLSIMYGI-----CQFWTYEQLSLMAKQTSYLADHQHLSNFLCGAAAGGAAVIIST 157

  Fly   152 PMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYL 216
            |:::.:||| ::.....|  :......:..||:.||.||.::||::.:|:..|...:.|:::...
  Fly   158 PLDVIRTRL-IAQDTSKG--YRNATRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLF 219

  Fly   217 ------------MRQVETPGVAYTLMA-GGCAGMSSWLACYPIDVVKTHMQ-------ADALGAN 261
                        ..|:.|    :||:. |..:||.|....||.|::|..:|       ....|..
  Fly   220 SDWACAFLEVSDRSQLPT----WTLLGLGASSGMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQT 280

  Fly   262 AKYNGFIDCAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACFFVV 305
            .:.:|..||.....|.||.:..::|:..||::: .|..|.:|.:
  Fly   281 LQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKS-SMTTALYFSI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 21/97 (22%)
PTZ00169 41..295 CDD:240302 67/292 (23%)
Mito_carr 128..218 CDD:278578 23/106 (22%)
Mito_carr 221..304 CDD:278578 24/90 (27%)
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 21/94 (22%)
PTZ00169 33..329 CDD:240302 70/304 (23%)
Mito_carr 153..222 CDD:278578 16/71 (23%)
Mito_carr 233..328 CDD:278578 26/96 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441378
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.