DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and Dic4

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:225 Identity:56/225 - (24%)
Similarity:86/225 - (38%) Gaps:38/225 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ITFIYRVNNDKDPYRKRGSEIGDIQLKATSETFSPKMVVDFVAGLLGGAAGVLVGHPFDTVKVHL 68
            |.||......|..|..|.|.:|             |:::..|||..|.|.|:    |.|.:.|.:
  Fly    89 IHFIVYDTGKKMEYVDRDSYLG-------------KIILGCVAGACGSAFGI----PTDLINVRM 136

  Fly    69 QTDDPRNP----KYKGTFHCFRTIVQRDKFIGLYRGIS--------SPMGGIGLVNAIVFGVYGN 121
            |||....|    .||..|.....|.:.:.:..||:|.|        |....|...:.|...|..|
  Fly   137 QTDMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKN 201

  Fly   122 VQRLSNDPNSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTE 186
            :.  .||  .|..||.......:....:..|:::.:|.:..|...:....|...:|.:::     
  Fly   202 IS--VND--GLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRF----- 257

  Fly   187 GIRGAFKGLTATILRDIPGFASYFVSFEYL 216
            |:.|.::|...||:|..|.....||.:|.|
  Fly   258 GVMGPYRGFVPTIVRKAPATTLLFVLYEQL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 27/100 (27%)
PTZ00169 41..295 CDD:240302 47/188 (25%)
Mito_carr 128..218 CDD:278578 20/89 (22%)
Mito_carr 221..304 CDD:278578
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 56/225 (25%)
Mito_carr 26..100 CDD:278578 3/10 (30%)
Mito_carr 104..201 CDD:278578 29/113 (26%)
Mito_carr 211..292 CDD:278578 18/82 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441391
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.