DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and Dic4

DIOPT Version :10

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_649054.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:225 Identity:56/225 - (24%)
Similarity:86/225 - (38%) Gaps:38/225 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ITFIYRVNNDKDPYRKRGSEIGDIQLKATSETFSPKMVVDFVAGLLGGAAGVLVGHPFDTVKVHL 68
            |.||......|..|..|.|.:|             |:::..|||..|.|.|:    |.|.:.|.:
  Fly    89 IHFIVYDTGKKMEYVDRDSYLG-------------KIILGCVAGACGSAFGI----PTDLINVRM 136

  Fly    69 QTDDPRNP----KYKGTFHCFRTIVQRDKFIGLYRGIS--------SPMGGIGLVNAIVFGVYGN 121
            |||....|    .||..|.....|.:.:.:..||:|.|        |....|...:.|...|..|
  Fly   137 QTDMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKN 201

  Fly   122 VQRLSNDPNSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTE 186
            :.  .||  .|..||.......:....:..|:::.:|.:..|...:....|...:|.:::     
  Fly   202 IS--VND--GLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRF----- 257

  Fly   187 GIRGAFKGLTATILRDIPGFASYFVSFEYL 216
            |:.|.::|...||:|..|.....||.:|.|
  Fly   258 GVMGPYRGFVPTIVRKAPATTLLFVLYEQL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:395101 27/100 (27%)
Mito_carr 128..218 CDD:395101 20/89 (22%)
Mito_carr 221..304 CDD:395101
Dic4NP_649054.1 Mito_carr 26..100 CDD:395101 3/10 (30%)
Mito_carr 104..201 CDD:395101 29/113 (26%)
Mito_carr 211..292 CDD:395101 18/82 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.