DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and CG6893

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster


Alignment Length:212 Identity:55/212 - (25%)
Similarity:85/212 - (40%) Gaps:34/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QLKATSETF-----------SPKMVVD--FVAGLLGGAAGVLVGHPFDTVKVHLQTDD--PRNPK 77
            ||..||..|           .|..::|  .||.|.|..||| ||.|.:.:...:|.:.  |:..:
  Fly    78 QLTYTSMRFHLYEMGKEHLDDPAGLLDKVLVAALAGCVAGV-VGTPMELINTRMQVNRALPKETR 141

  Fly    78 --YKGTFHCFRTIVQRDKFIGLYRGISSPMGGIGLVNAIVFGVYGNVQRL------SNDPNSLTS 134
              |:..|.....:.:.:.|..||.|.........|:.......|...:::      ....|:|. 
  Fly   142 WNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDNTLL- 205

  Fly   135 HFFAGSIAGVAQGFVCAPMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATI 199
            |.    |:.|...|||.|:......|:....|||    ...|:.:.|:::. |.||.|:|:...:
  Fly   206 HL----ISSVTAAFVCGPIIKPIENLRYLRMVDS----RRLINSISYMMRF-GSRGPFRGMVPYV 261

  Fly   200 LRDIPGFASYFVSFEYL 216
            ||.:|.....|:|||.|
  Fly   262 LRMVPNTVITFLSFEQL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 23/105 (22%)
PTZ00169 41..295 CDD:240302 49/188 (26%)
Mito_carr 128..218 CDD:278578 28/89 (31%)
Mito_carr 221..304 CDD:278578
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 5/17 (29%)
Mito_carr 98..192 CDD:395101 22/94 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441392
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.