DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and slc25a20

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_989099.1 Gene:slc25a20 / 394703 XenbaseID:XB-GENE-971451 Length:301 Species:Xenopus tropicalis


Alignment Length:288 Identity:104/288 - (36%)
Similarity:156/288 - (54%) Gaps:28/288 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ETFSPKMVVDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPR-----NPKYKGTFHCFRTIVQRDK 93
            :..||  :.:|.||..||...|..|||.||:||.:|| .|:     .|.|.|||.||:..:..:.
 Frog     6 QPISP--MKNFFAGGFGGICLVFAGHPLDTIKVRIQT-QPKPVPGIPPLYSGTFDCFKKTLVNEG 67

  Fly    94 FIGLYRGISSPMGGIGLVNAIVFGVYGNVQRL-SNDPNSLTSH---FFAGSIAGVAQGFVCAPME 154
            ..|||:|:::|:.|:..:.|:.|..:|..::| ...|..:.::   |.||.::||....:.||.|
 Frog    68 LRGLYKGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDILTYPQLFAAGMLSGVFTTAIMAPGE 132

  Fly   155 LAKTRLQLSTQVDSG-IKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMR 218
            ..|..||:  |..|| :|:.||:.|.|.:.:..||||.:||...|::||:|....||:::|:| :
 Frog   133 RIKCLLQI--QAASGEVKYAGPMDCAKQLYREAGIRGIYKGTVLTLMRDVPASGMYFMTYEWL-K 194

  Fly   219 QVETP--------GVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKY-NGFIDCAMKG 274
            .:.||        .|...|.|||.||:.:|....|.||:|:..|....|   || |||.|...:.
 Frog   195 NILTPEGHSVSELSVPKILFAGGMAGIFNWAVAIPPDVLKSRFQTAPAG---KYPNGFRDVLREL 256

  Fly   275 FRNEGPQYFFRGLNSTLIRAFPMNAACF 302
            .|.||....::|..:.::||||.|||||
 Frog   257 IREEGIGSLYKGFTAVMLRAFPANAACF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 34/93 (37%)
PTZ00169 41..295 CDD:240302 94/272 (35%)
Mito_carr 128..218 CDD:278578 34/93 (37%)
Mito_carr 221..304 CDD:278578 35/91 (38%)
slc25a20NP_989099.1 Mito_carr 8..102 CDD:365909 35/96 (36%)
Mito_carr 108..198 CDD:365909 33/92 (36%)
Mito_carr 207..294 CDD:365909 33/81 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1756
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.