DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and Tpc2

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:305 Identity:79/305 - (25%)
Similarity:129/305 - (42%) Gaps:65/305 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VAGLLGGAAGVLVGHPFDTVKVHLQTD-DP----RNPKYKGTFHCFRTIVQRDKFIGLYRGISSP 104
            |.|.:.|||...:..|.|.:|:..|.. :|    :..||:|..|.|:::...:...|::||.:| 
  Fly    14 VGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRGHNS- 77

  Fly   105 MGGIGLVNAIVFGVYGNVQRLSNDPNSLTSH-------------FFAGSIAGVAQGFVCAPMELA 156
                |.|.:|   .|..||..|.:.....:|             |..|.|||........|.::.
  Fly    78 ----GQVLSI---SYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCLGAVAAQPFDVV 135

  Fly   157 KT----------RLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFV 211
            :|          |.|::|       |||    |:.:.|.||..|..:||..|:::..|...:.|:
  Fly   136 RTQMVAADPSSRRSQMNT-------FTG----LRKVYKMEGWMGLSRGLPFTLVQVFPLVGANFL 189

  Fly   212 SFEYLMRQV----------ETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADA-------LG 259
            .::||...|          |..| |:..:.|..:|:.:.:..||.|::|..:|..|       .|
  Fly   190 FYKYLNAAVLMAKPPDQRQEIHG-AFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFG 253

  Fly   260 ANAKYNGFIDCAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACFFV 304
            .|.:....:.|....||.||...|::|:..||::|..|:|..|.:
  Fly   254 RNPECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 25/84 (30%)
PTZ00169 41..295 CDD:240302 75/294 (26%)
Mito_carr 128..218 CDD:278578 26/112 (23%)
Mito_carr 221..304 CDD:278578 26/89 (29%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 74/296 (25%)
Mito_carr 23..99 CDD:278578 21/83 (25%)
Mito_carr 108..194 CDD:278578 23/96 (24%)
Mito_carr 216..307 CDD:278578 23/83 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441379
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.