DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and CG8026

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:309 Identity:90/309 - (29%)
Similarity:140/309 - (45%) Gaps:47/309 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LKATSETFSPKMVVDF--------VAGLLGGAAGVLVGHPFDTVKVHLQTDDPRN---PKYKGTF 82
            :||.| |.|||....|        |||:.||....|:.||.|.:|:....:|.|.   |:|:|..
  Fly     4 IKAQS-TGSPKKFNVFAHVKYEHLVAGVSGGVVSTLILHPLDLIKIRFAVNDGRTATVPQYRGLS 67

  Fly    83 HCFRTIVQRDKFIGLYRGISSPMGGIGLVNAIVFGVYGNVQRLSNDPNSL-----TSHFFAGSIA 142
            ..|.||.:::.|.|||:|::..:.|.|....:.|..|..::......|:.     |.:..|.:.:
  Fly    68 SAFTTIFRQEGFRGLYKGVTPNVWGSGSSWGLYFMFYNTIKTFIQGGNTTMPLGPTMNMLAAAES 132

  Fly   143 GVAQGFVCAPMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGF- 206
            |:....:..|:.:.||||.|.....|..::.|.||.|..|.|.|||||.::|.       :||. 
  Fly   133 GILTLLLTNPIWVVKTRLCLQCDAASSAEYRGMIHALGQIYKEEGIRGLYRGF-------VPGML 190

  Fly   207 -----ASYFVSF--------EYLMRQVETPGVAYTLMAGGCAGMSSWLAC---YPIDVVKTHMQA 255
                 |..|:::        ||....::|.......:|  .|.:|..:|.   ||..||:..:| 
  Fly   191 GVSHGAIQFMTYEELKNAYNEYRKLPIDTKLATTEYLA--FAAVSKLIAAAATYPYQVVRARLQ- 252

  Fly   256 DALGANAKYNGFIDCAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACFFV 304
               ..:.:|||..||..:.:|.||.:.|::||.::|.|..|.....|.|
  Fly   253 ---DHHHRYNGTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 31/99 (31%)
PTZ00169 41..295 CDD:240302 80/286 (28%)
Mito_carr 128..218 CDD:278578 29/108 (27%)
Mito_carr 221..304 CDD:278578 25/85 (29%)
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 80/286 (28%)
Mito_carr 23..115 CDD:278578 27/91 (30%)
Mito_carr 119..213 CDD:278578 27/100 (27%)
Mito_carr 220..307 CDD:278578 25/85 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441385
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.