DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and Dic3

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:272 Identity:71/272 - (26%)
Similarity:108/272 - (39%) Gaps:30/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GG--AAGVLVG-HPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPMGGIGLV 111
            ||  ||..:.| ||.|.:||.|||....:.|..|  ...:.|.:|...:|.|.|||:........
  Fly    15 GGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVG--EILKGIHERSGILGFYNGISASWFRQLTY 77

  Fly   112 NAIVFGVYGNVQRLSNDPNSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQLSTQVDSGIK----- 171
            ....|.:| ...:...|...::|.....:.||:..|.|..|.::...|||...::....:     
  Fly    78 TTTRFALY-EAGKDYVDTQKVSSKMALATFAGIVGGIVGVPGDVVTVRLQNDVKLPEEKRRNYKH 141

  Fly   172 -FTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYL--MRQVET---PGVAYTLM 230
             |.|    |..|.|.||:...|:|....:.|.:........:::.:  |.::.|   .||.....
  Fly   142 VFDG----LFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATGAGEGVPLHFA 202

  Fly   231 AGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGF--IDCAMKGFRNEGPQYFFRGLNSTLIR 293
            ....||..:.:...|:||:||...      ||:...|  |..|......:||..|::|....|||
  Fly   203 TSTIAGCIAVVITQPLDVIKTTFM------NAQPGEFSGIGGAFLSTAKQGPLAFYKGFIPALIR 261

  Fly   294 AFPMNAACFFVV 305
            ..| |....||:
  Fly   262 VSP-NTIITFVL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 24/77 (31%)
PTZ00169 41..295 CDD:240302 67/260 (26%)
Mito_carr 128..218 CDD:278578 20/97 (21%)
Mito_carr 221..304 CDD:278578 24/87 (28%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 71/272 (26%)
Mito_carr 15..91 CDD:278578 24/78 (31%)
Mito_carr 93..187 CDD:278578 20/97 (21%)
Mito_carr 200..281 CDD:278578 23/80 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441393
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.