DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and CG9582

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster


Alignment Length:295 Identity:75/295 - (25%)
Similarity:131/295 - (44%) Gaps:36/295 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHC-FRTIVQRDKFIG---LYRGISSP 104
            |:||.|.|...::..||.|.||..:|.........:..:.| ...||:..::.|   |::||..|
  Fly    17 FLAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGIVPP 81

  Fly   105 M-------GGIGLVNAIVFGVYGNV----QRLSNDPNSLTSHFFAGSIAGVAQGFVCAPMELAKT 158
            :       ||       .|.:|.::    |..:..|..|| |..:||:|.:.:.|:..|.|:.| 
  Fly    82 ICVETPKRGG-------KFLMYESLKPYFQFGAPQPTPLT-HAMSGSMAAILESFLVNPFEVVK- 137

  Fly   159 RLQLSTQVDSGIKFTGPIHCLKYIVKTE--GIRGAFKGLTATILRDIPGFASYFVSFEYLMRQVE 221
               ::.|...| |....:..:|||:|.:  ||:|.::|:||.:.|:......:|..:..|...|.
  Fly   138 ---ITQQAHRG-KRLKTLSVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNALKDIVP 198

  Fly   222 TP-GVAYTLMAGG-CAGMSSWLAC---YPIDVVKTHMQA-DALGANAKYNGFIDCAMKGFRNEGP 280
            :| ...|.::... .||::|.|||   ..:|:.|..:|. ..:....||...|......|:.||.
  Fly   199 SPEDKTYNILRKVIIAGLASSLACVMSVTLDMAKCRIQGPQPVKGEVKYQWTISTIKSTFKEEGF 263

  Fly   281 QYFFRGLNSTLIRAFPMNAACFFVVSWVLDICNAK 315
            :..|:||.:.::|..|..|.......::.:...::
  Fly   264 RSLFKGLGAMILRVGPGGAMLLVTYEYLFEFLKSQ 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 24/95 (25%)
PTZ00169 41..295 CDD:240302 73/273 (27%)
Mito_carr 128..218 CDD:278578 27/91 (30%)
Mito_carr 221..304 CDD:278578 23/88 (26%)
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 75/291 (26%)
Mito_carr 17..104 CDD:278578 23/93 (25%)
Mito_carr 109..196 CDD:278578 27/92 (29%)
Mito_carr 216..295 CDD:278578 19/78 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441409
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.