DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and Slc25a48

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_808477.2 Gene:Slc25a48 / 328258 MGIID:2145373 Length:306 Species:Mus musculus


Alignment Length:306 Identity:114/306 - (37%)
Similarity:167/306 - (54%) Gaps:46/306 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IGDIQLKATSETFSPKMVVDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTI 88
            :|..||:            |||||.:||.|.|:||:|.||||..||.    ...|..||:|.|.:
Mouse     1 MGSFQLE------------DFVAGWIGGVASVIVGYPLDTVKTRLQA----GVGYANTFNCIRMV 49

  Fly    89 VQRDKFIGLYRGISSPMGGIGLVNAIVFGVYGNVQR---------LSNDP-NSLTSHFFAGSIAG 143
            .:|::..|.::|:|.|:..|.:.|::||||:.|.||         |...| .||:....|..:.|
Mouse    50 YKRERVFGFFKGMSFPLASIAIYNSVVFGVFSNTQRFLSKYRCGELEAGPGRSLSDLLLASMLTG 114

  Fly   144 VAQGFVCAPMELAKTRLQLSTQ----VDSGIK------FTGPIHCLKYIVKTEGIRGAFKGLTAT 198
            |....:..|:||.|.|||:.||    ...|:|      :.||:||:..||:.||:.|.::|.:|.
Mouse   115 VVSVGLGGPVELIKIRLQMQTQPFREASHGLKSRAVAAYQGPVHCIATIVQMEGLTGLYRGASAM 179

  Fly   199 ILRDIPGFASYFVSFEYLMRQV-------ETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQAD 256
            :||||||:..||:.:.:|...:       .:|..|:  :|||.||..||....|:||||:.:|||
Mouse   180 LLRDIPGYCFYFIPYVFLSEWITPEACTGPSPYAAW--LAGGIAGAISWGTATPMDVVKSRIQAD 242

  Fly   257 ALGANAKYNGFIDCAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACF 302
            .:..| ||.|.:||..:.::.||.:.||||:....:|.|||:||.|
Mouse   243 GVYLN-KYRGVVDCISQSYQQEGFKVFFRGITVNAVRGFPMSAAMF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 37/97 (38%)
PTZ00169 41..295 CDD:240302 105/280 (38%)
Mito_carr 128..218 CDD:278578 37/100 (37%)
Mito_carr 221..304 CDD:278578 36/82 (44%)
Slc25a48NP_808477.2 Solcar 1 3..86 38/98 (39%)
Mito_carr 6..89 CDD:365909 38/98 (39%)
Solcar 2 101..200 36/98 (37%)
Mito_carr 107..202 CDD:365909 34/94 (36%)
Mito_carr 209..299 CDD:365909 36/82 (44%)
Solcar 3 209..296 36/82 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X353
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.