DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and Ucp4A

DIOPT Version :10

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_573246.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:191 Identity:52/191 - (27%)
Similarity:84/191 - (43%) Gaps:11/191 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VAGLLGGAAGVLVGHPFDTVKVHLQTDDPRN-----PKYKGTFHCFRTIVQRDKFIGLYRGISSP 104
            :.|:..||....:..|.|.|||.:|.:..|.     |:.....|.||.||||....||::|....
  Fly   149 LCGVTAGAVAQWLASPADLVKVQIQMEGRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPN 213

  Fly   105 MGGIGLVNAIVFGVYGNVQRLSND----PNSLTSHFFAGSIAGVAQGFVCAPMELAKTRL--QLS 163
            :....|||......|..::.|..:    |:..|.|..|...||.....:..|.::.|||:  |.:
  Fly   214 VQRAALVNLGDLTTYDTIKHLIMNRL
QMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPT 278

  Fly   164 TQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQVETPG 224
            .:...|:.:.|.:.||:..|..||....:||.....:|..|...::::|||.:.:.:...|
  Fly   279 DENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKMIG
ASG 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:395101 25/84 (30%)
Mito_carr 128..218 CDD:395101 25/95 (26%)
Mito_carr 221..304 CDD:395101 1/4 (25%)
Ucp4ANP_573246.1 Mito_carr 39..138 CDD:395101
Mito_carr 142..239 CDD:395101 26/89 (29%)
Mito_carr 248..336 CDD:395101 23/87 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.