Sequence 1: | NP_609380.1 | Gene: | CG4995 / 34390 | FlyBaseID: | FBgn0032219 | Length: | 399 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001259432.1 | Gene: | Ant2 / 32008 | FlyBaseID: | FBgn0025111 | Length: | 307 | Species: | Drosophila melanogaster |
Alignment Length: | 213 | Identity: | 60/213 - (28%) |
---|---|---|---|
Similarity: | 92/213 - (43%) | Gaps: | 32/213 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 128 DPNSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQ---LSTQVDSGIKFTGPIHCLKYIVKTEGIR 189
Fly 190 GAFKGLTATILRDIPGFASYFVSFEYLMRQVETPGV----------AYTLMAGGCAGMSSWLACY 244
Fly 245 PIDVVKTHMQAD-ALGANAKYNGFIDCAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACF------ 302
Fly 303 -----------FVVSWVL 309 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4995 | NP_609380.1 | Mito_carr | 36..125 | CDD:278578 | |
PTZ00169 | 41..295 | CDD:240302 | 53/180 (29%) | ||
Mito_carr | 128..218 | CDD:278578 | 24/92 (26%) | ||
Mito_carr | 221..304 | CDD:278578 | 31/110 (28%) | ||
Ant2 | NP_001259432.1 | PTZ00169 | 15..305 | CDD:240302 | 59/212 (28%) |
Mito_carr | 17..111 | CDD:278578 | 24/94 (26%) | ||
Mito_carr | 119..215 | CDD:278578 | 29/95 (31%) | ||
Mito_carr | 218..307 | CDD:278578 | 4/8 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45441407 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |