DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and Ant2

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:213 Identity:60/213 - (28%)
Similarity:92/213 - (43%) Gaps:32/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 DPNSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQ---LSTQVDSGIKFTGPIHCLKYIVKTEGIR 189
            |..|....|..|.::........||:|..|..||   :|.|:.:..::.|.:.|...|.|.:|..
  Fly    14 DLKSFLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFS 78

  Fly   190 GAFKGLTATILRDIPGFASYFVSFEYLMRQVETPGV----------AYTLMAGGCAGMSSWLACY 244
            ..::|..|.::|..|..|..| :|:.:.:.|...||          |..|.:||.||.:|....|
  Fly    79 SFWRGNLANVIRYFPTQALNF-AFKDVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSLCFVY 142

  Fly   245 PIDVVKTHMQAD-ALGANAKYNGFIDCAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACF------ 302
            |:|..:|.:.|| ..|.|.::||.|||.||..:::||...:||...::.......||.|      
  Fly   143 PLDFARTRLAADVGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTC 207

  Fly   303 -----------FVVSWVL 309
                       |.|||.:
  Fly   208 RDFLPNPKSTPFYVSWAI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578
PTZ00169 41..295 CDD:240302 53/180 (29%)
Mito_carr 128..218 CDD:278578 24/92 (26%)
Mito_carr 221..304 CDD:278578 31/110 (28%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 59/212 (28%)
Mito_carr 17..111 CDD:278578 24/94 (26%)
Mito_carr 119..215 CDD:278578 29/95 (31%)
Mito_carr 218..307 CDD:278578 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441407
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.