DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and sesB

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:311 Identity:80/311 - (25%)
Similarity:121/311 - (38%) Gaps:58/311 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IGDIQLKATSETFSPK------MVVDFVAGLLGGAAGVLVGHPFDTVKV-----HLQTDDPRNPK 77
            :|:|....||::...|      .|.||.||.:..|.......|.:.||:     |:......:.:
  Fly     1 MGNISASITSQSKMGKDFDAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQ 65

  Fly    78 YKGTFHCFRTIVQRDKFIGLYRGISSPMGGIGLVNAIVF-----------GVYGNVQRLSNDPNS 131
            |||...||..|.:...|...:||        .|.|.|.:           ..|..|.....|.|:
  Fly    66 YKGMVDCFIRIPKEQGFSSFWRG--------NLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNT 122

  Fly   132 LTSHFFAGSIA-GVAQG-----FVCAPMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRG 190
            ....:|||::| |.|.|     || .|::.|:|||...|......:|||..:||..|.|::||.|
  Fly   123 QFWRYFAGNLASGGAAGATSLCFV-YPLDFARTRLAADTGKGGQREFTGLGNCLTKIFKSDGIVG 186

  Fly   191 AFKGLTATILRDIPGFASYFVSFEYLMRQVETP-----------GVAYTLMAGGCAGMSSWLACY 244
            .::|...::...|...|:||..::.....:..|           ....|.:||        :..|
  Fly   187 LYRGFGVSVQGIIIYRAAYFGFYDTARGMLPDPKNTPIYISWAIAQVVTTVAG--------IVSY 243

  Fly   245 PIDVVKTH--MQADALGANAKYNGFIDCAMKGFRNEGPQYFFRGLNSTLIR 293
            |.|.|:..  ||:........|...:.|.....:.||...||:|..|.::|
  Fly   244 PFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 25/110 (23%)
PTZ00169 41..295 CDD:240302 75/288 (26%)
Mito_carr 128..218 CDD:278578 32/95 (34%)
Mito_carr 221..304 CDD:278578 19/86 (22%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 24/104 (23%)
PTZ00169 23..312 CDD:240302 75/289 (26%)
Mito_carr 124..220 CDD:278578 30/96 (31%)
Mito_carr 223..312 CDD:278578 18/80 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.