DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and CG1628

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:300 Identity:95/300 - (31%)
Similarity:145/300 - (48%) Gaps:52/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VVDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPK-YKGTFHCFRTIVQRDKFI-GLYRGISS 103
            ::||:||.|||||.|.|..|.|||||.|||    .|: |:|...||.:..::|..: |||.|...
  Fly   170 LIDFLAGSLGGAAQVYVSQPLDTVKVKLQT----FPEAYRGMLDCFLSTYRKDGVLRGLYAGSVP 230

  Fly   104 PMGGIGLVNAIVFGVYGNVQRL------SNDPNSLTS--HFFAGSIAGVAQGFVCAPMELAKTRL 160
            .:......|:::|..||..|:.      ......||:  :..|||:|.........|.||.|.:|
  Fly   231 AVFANVAENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTELIKCKL 295

  Fly   161 QLSTQVDSGIKFTGPIH---------CLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFE-- 214
            |...::.:   |..|.|         ..:||.:||||||.::||::|.||::||:..:|.|:|  
  Fly   296 QALREMKN---FVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFGSYEGT 357

  Fly   215 -YLMRQVETP----GVAYTLMAGGCAGMSSWLACYPIDVVKTHMQAD-------ALGANAKYNGF 267
             .|:|:.:..    |...|::||...|:..|.:.:|.||:|:.:|..       |:||:.     
  Fly   358 RELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNESMFAVGADI----- 417

  Fly   268 IDCAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACFFVVSW 307
                   .|.||....:|||..:::|..|..|..|.|..:
  Fly   418 -------VRREGVLALYRGLLPSVLRTIPATATLFVVYEY 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 35/85 (41%)
PTZ00169 41..295 CDD:240302 91/286 (32%)
Mito_carr 128..218 CDD:278578 34/103 (33%)
Mito_carr 221..304 CDD:278578 24/93 (26%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 95/299 (32%)
Mito_carr 170..252 CDD:278578 35/85 (41%)
Mito_carr 263..364 CDD:278578 35/103 (34%)
Mito_carr 369..455 CDD:278578 25/93 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441388
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45624
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.