DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and CG5254

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster


Alignment Length:192 Identity:66/192 - (34%)
Similarity:94/192 - (48%) Gaps:19/192 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TSETFSPKMVVDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRD--KF 94
            |..|||       :|||..|....:..:||:.|||..|.|  |..|...||...:.|:|:|  .|
  Fly   116 TPLTFS-------LAGLTAGTLEAIAVNPFEVVKVAQQAD--RQKKMLSTFAVAKGIIQQDGLGF 171

  Fly    95 IGLYRGISSPMGGIGLVNAIVFGVYGNVQRLSNDPNSLTSHF------FAGSIAGVAQGFVCAPM 153
            .||.:||::.||..|:.|.:.||.|.:|:.:.  |....||.      ..|.:||....||..|.
  Fly   172 SGLNKGITATMGRNGVFNMVYFGFYHSVKNVV--PEYKESHLEFLRKVTIGFLAGTLACFVNIPF 234

  Fly   154 ELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEY 215
            ::||:|:|....|...||:.|.:..:..:.:.||.|..:|||...|:|..||.|...:.|||
  Fly   235 DVAKSRIQGPQPVPGQIKYRGTLSSMGIVYREEGFRALYKGLVPKIMRLGPGGAILLLVFEY 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 33/90 (37%)
PTZ00169 41..295 CDD:240302 62/183 (34%)
Mito_carr 128..218 CDD:278578 31/94 (33%)
Mito_carr 221..304 CDD:278578
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578
PTZ00169 19..301 CDD:240302 66/192 (34%)
Mito_carr 122..207 CDD:278578 32/88 (36%)
Mito_carr 209..305 CDD:278578 30/88 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441408
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.