DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and Slc25a15

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001041345.1 Gene:Slc25a15 / 306574 RGDID:1311488 Length:338 Species:Rattus norvegicus


Alignment Length:327 Identity:95/327 - (29%)
Similarity:139/327 - (42%) Gaps:72/327 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKG-TFHCFRTIVQRDKFIGLYRGISSPM 105
            :|..||..||.|.||.|.||||:||.:||..   ..|:| |..|.||..|.. |.|.|:|.|..:
  Rat    11 IDLTAGAAGGTACVLTGQPFDTMKVKMQTFP---DLYRGLTDCCLRTYSQVG-FRGFYKGTSPAL 71

  Fly   106 GGIGLVNAIVFGVYGNVQ-------------RLSNDPNSLTSHFFAGSIAGVAQGFVCAPMELAK 157
            ......|:::|..||..|             :||:..|:.     |||.|......|..|.||.|
  Rat    72 IANIAENSVLFMCYGFCQQVVRKVVGLDRQAKLSDLQNAA-----AGSFASAFAALVLCPTELVK 131

  Fly   158 TRLQLSTQVDSGIKFTGPIH----CLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLM- 217
            .|||...::::..|.....:    .:|.|.:.:|..|.:.||::|:||::||:..:|..:|... 
  Rat   132 CRLQTMYEMETSGKIAASQNTVWSVVKEIFRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRS 196

  Fly   218 -----RQVETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRN 277
                 |..:..|....:::||..|:..|||.||:|.:|:.:|  .|....|..|.|...:...:|
  Rat   197 FFASGRSKDELGPIPLMLSGGFGGICLWLAVYPVDCIKSRIQ--VLSMTGKQTGLIRTFLSIVKN 259

  Fly   278 EG----------------PQ---------------------YFFRGLNSTLIRAFPMNAACFFVV 305
            ||                |:                     ..:.||..|:|||||.|.|.|...
  Rat   260 EGGYRLSESRLYDVSFVQPKTCLSGVHYVGILKLGLREGITALYSGLKPTMIRAFPANGALFLAY 324

  Fly   306 SW 307
            .:
  Rat   325 EY 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 34/96 (35%)
PTZ00169 41..295 CDD:240302 89/313 (28%)
Mito_carr 128..218 CDD:278578 27/99 (27%)
Mito_carr 221..304 CDD:278578 31/119 (26%)
Slc25a15NP_001041345.1 Mito_carr 9..94 CDD:395101 34/86 (40%)
Mito_carr <122..198 CDD:395101 22/75 (29%)
Mito_carr 205..332 CDD:395101 31/124 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.