DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and SPAC4G9.20c

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_593701.2 Gene:SPAC4G9.20c / 2543680 PomBaseID:SPAC4G9.20c Length:298 Species:Schizosaccharomyces pombe


Alignment Length:279 Identity:95/279 - (34%)
Similarity:141/279 - (50%) Gaps:16/279 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPMGG 107
            ||:||:.||.|.||||.|||.|||.||:....:|.|.....|.:.|.:.:.....|:|...|:.|
pombe    16 DFLAGVSGGVAQVLVGQPFDCVKVRLQSQSNVSPIYNNALDCVKKISKNEGLAAFYKGTVLPLLG 80

  Fly   108 IGLVNAIVFGVYGNVQR-LSND--PNSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQLSTQVDSG 169
            ||...:|.|..:...:| .|.|  |.::..::.:|:|:|:|..|:..|:|..:.|||:  |....
pombe    81 IGFCVSIQFTTFEYCKRFFSRDGTPVTMPQYYVSGAISGLANSFLVGPVEHVRIRLQI--QTGKN 143

  Fly   170 IKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQV----------ETPG 224
            :.:.||..|:|.|....|:.|..||...|..|:..|...||:::|.|::..          :|||
pombe   144 VLYHGPWDCIKKISSQYGLSGIMKGYNPTAAREAHGLGMYFLAYEALVKNTMAKHHLTDRSQTPG 208

  Fly   225 VAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNEGPQYFFRGLNS 289
            ....:...| ||.:.|||.||.|:||:.:|.|...:.|.|.....||...:...|.:.|:||...
pombe   209 WKLCVFGAG-AGYAMWLAAYPFDIVKSKIQTDGFLSKATYKNSWQCAKGIYTKAGLRGFYRGFVP 272

  Fly   290 TLIRAFPMNAACFFVVSWV 308
            .|:||.|.||..|:|...|
pombe   273 VLVRAAPANAVTFYVYETV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 32/82 (39%)
PTZ00169 41..295 CDD:240302 88/264 (33%)
Mito_carr 128..218 CDD:278578 29/91 (32%)
Mito_carr 221..304 CDD:278578 31/82 (38%)
SPAC4G9.20cNP_593701.2 PTZ00169 15..286 CDD:240302 92/272 (34%)
Mito_carr 15..103 CDD:278578 33/86 (38%)
Mito_carr 105..198 CDD:278578 28/94 (30%)
Mito_carr 204..297 CDD:278578 33/89 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I2789
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1238
OMA 1 1.010 - - QHG54095
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 1 1.000 - - oto102084
orthoMCL 1 0.900 - - OOG6_101471
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1756
SonicParanoid 1 1.000 - - X353
TreeFam 1 0.960 - -
109.860

Return to query results.
Submit another query.