DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and SPBC29A3.11c

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_595839.1 Gene:SPBC29A3.11c / 2540397 PomBaseID:SPBC29A3.11c Length:297 Species:Schizosaccharomyces pombe


Alignment Length:280 Identity:66/280 - (23%)
Similarity:116/280 - (41%) Gaps:38/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPMGGI 108
            |.|.|:..|...::|:|.|::||..||.:     :.....||:..|:.:...|||||::.|:...
pombe    21 FSAALVSSAISNVIGYPLDSIKVRQQTYN-----FPTIRSCFQNAVKNEGLKGLYRGLTLPLISA 80

  Fly   109 GLVNAIVFGVYGNVQRLSNDPNSLTSHFFAGSIAGVAQGFVCAPME-----------LAKTRLQL 162
            .|..::.|.||.:::......:....:|.:|...|........|.|           |.||.:..
pombe    81 TLSRSVSFTVYDSLKLTFAHVDPTLRYFISGLGTGTFISLFACPFEYSKLYSQIDMLLRKTNMGR 145

  Fly   163 STQVDSGIKFTGPIHCLKY---IVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQV---- 220
            ..:.:|.:....|:...:.   ||:..|....:.|....:.||..|.|.||..:|...:.:    
pombe   146 RQETNSKLSVRPPLSSFQSASDIVRRYGFTALWNGYRYHLTRDALGSACYFTIYETFKKNLIAND 210

  Fly   221 ETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNEGPQYFF- 284
            ..|..||. .:|...|..||:..:|:|..|:.:|.:.|           .::|...:..|...| 
pombe   211 VKPHFAYA-FSGAFCGALSWILVFPVDTAKSIVQRNTL-----------LSIKTPLSSIPWLSFT 263

  Fly   285 --RGLNSTLIRAFPMNAACF 302
              ||:..:|:|:..:|:..|
pombe   264 IYRGIGISLMRSALINSCNF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 24/80 (30%)
PTZ00169 41..295 CDD:240302 64/271 (24%)
Mito_carr 128..218 CDD:278578 21/103 (20%)
Mito_carr 221..304 CDD:278578 21/85 (25%)
SPBC29A3.11cNP_595839.1 Mito_carr 16..98 CDD:278578 24/81 (30%)
Mito_carr 103..207 CDD:278578 21/103 (20%)
Mito_carr 210..291 CDD:278578 21/86 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.