DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and SLC25A29

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001339750.1 Gene:SLC25A29 / 123096 HGNCID:20116 Length:356 Species:Homo sapiens


Alignment Length:267 Identity:128/267 - (47%)
Similarity:176/267 - (65%) Gaps:13/267 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPMGGIGLVNAIV 115
            |.||||||||||||||.||......|:|:||.|||::|::::..:|||:|:.||:.|:..:||:|
Human    65 GVAGVLVGHPFDTVKVRLQVQSVEKPQYRGTLHCFKSIIKQESVLGLYKGLGSPLMGLTFINALV 129

  Fly   116 FGVYGNVQR-LSNDPNSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQLSTQVDSG--IKFTGPIH 177
            |||.||..| |.:|  |..:.|.||:.||..|..:|.|||||||||||.   |:|  ..:.|.:.
Human   130 FGVQGNTLRALGHD--SPLNQFLAGAAAGAIQCVICCPMELAKTRLQLQ---DAGPARTYKGSLD 189

  Fly   178 CLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQVE-TPG----VAYTLMAGGCAGM 237
            ||..|...||:||..:|:.:|:||:.|.|..||::::.|.|.:. .||    |...|:|||.:|:
Human   190 CLAQIYGHEGLRGVNRGMVSTLLRETPSFGVYFLTYDALTRALGCEPGDRLLVPKLLLAGGTSGI 254

  Fly   238 SSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACF 302
            .|||:.||:||||:.:|||.|....:|.|.:||..:.:|.||.:.|.|||.|||:||||:|||.|
Human   255 VSWLSTYPVDVVKSRLQADGLRGAPRYRGILDCVHQSYRAEGWRVFTRGLASTLLRAFPVNAATF 319

  Fly   303 FVVSWVL 309
            ..|:.||
Human   320 ATVTVVL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 41/74 (55%)
PTZ00169 41..295 CDD:240302 118/251 (47%)
Mito_carr 128..218 CDD:278578 39/91 (43%)
Mito_carr 221..304 CDD:278578 43/87 (49%)
SLC25A29NP_001339750.1 Mito_carr 65..132 CDD:278578 36/66 (55%)
Mito_carr 141..233 CDD:278578 40/96 (42%)
Mito_carr 238..321 CDD:278578 41/82 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159712
Domainoid 1 1.000 109 1.000 Domainoid score I6380
eggNOG 1 0.900 - - E1_KOG0762
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5385
Inparanoid 1 1.050 255 1.000 Inparanoid score I3182
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 1 1.000 - - oto91662
orthoMCL 1 0.900 - - OOG6_101471
Panther 1 1.100 - - LDO PTHR45624
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1756
SonicParanoid 1 1.000 - - X353
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.