DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and Slc25a47

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_011242283.1 Gene:Slc25a47 / 104910 MGIID:2144766 Length:313 Species:Mus musculus


Alignment Length:298 Identity:104/298 - (34%)
Similarity:156/298 - (52%) Gaps:44/298 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPMGGIGLVNAIV 115
            |..||.||:|.|||||.:||:    .||.|.:||.|...::::..|.|||:|.|:..:.||:::.
Mouse    13 GVCGVAVGYPLDTVKVRIQTE----AKYAGIWHCIRDTYRQERVWGFYRGLSLPVCTVSLVSSVS 73

  Fly   116 FGVY----GNVQRL---SNDPNSLTSHF-FAGSIAGVAQGFVCAPMELAKTRLQLSTQVD----- 167
            ||.|    .::.|.   |.|.....:.. .:|..:|:.:.|:.:|.|:||.|||..||..     
Mouse    74 FGTYHHCLAHICRFRYGSTDAKPTKADITLSGCASGLVRVFLTSPTEVAKVRLQTQTQAQTQQRR 138

  Fly   168 ------SGI---------------KFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFV 211
                  ||.               |::||:|||..:.:.||:||.:||.:|.:||:...||:||:
Mouse   139 SSASWTSGAPALCPTPTACLEPRPKYSGPLHCLVTVAREEGLRGLYKGSSALLLREGHSFATYFL 203

  Fly   212 SFEYLMRQV-----ETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCA 271
            |:..|...:     ..|.|...|:||||||:.:|....|:||:|:.:|||..|.: :|.|.:.|.
Mouse   204 SYAMLCEWLTPAGHSQPDVLGVLVAGGCAGVLAWAVATPMDVIKSRLQADGQGQH-RYRGLLHCV 267

  Fly   272 MKGFRNEGPQYFFRGLNSTLIRAFPMNAACFFVVSWVL 309
            :...|.|||:..|:||.....||||:|...|.....||
Mouse   268 VTSVREEGPRVLFKGLALNCCRAFPVNMVVFVAYEAVL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 30/77 (39%)
PTZ00169 41..295 CDD:240302 97/282 (34%)
Mito_carr 128..218 CDD:278578 36/116 (31%)
Mito_carr 221..304 CDD:278578 34/82 (41%)
Slc25a47XP_011242283.1 Mito_carr 13..77 CDD:365909 29/67 (43%)
Mito_carr 103..213 CDD:365909 35/109 (32%)
Mito_carr 226..307 CDD:365909 34/81 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0762
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X353
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.