DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and SLC25A15

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_055067.1 Gene:SLC25A15 / 10166 HGNCID:10985 Length:301 Species:Homo sapiens


Alignment Length:289 Identity:91/289 - (31%)
Similarity:137/289 - (47%) Gaps:33/289 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPMG 106
            :|..||..||.|.||.|.||||:||.:||..   ..|:|...|......:..|.|.|:|.|..:.
Human    11 IDLTAGAAGGTACVLTGQPFDTMKVKMQTFP---DLYRGLTDCCLKTYSQVGFRGFYKGTSPALI 72

  Fly   107 GIGLVNAIVFGVYGNVQ-------------RLSNDPNSLTSHFFAGSIAGVAQGFVCAPMELAKT 158
            .....|:::|..||..|             :||:..|:.     |||.|......|..|.||.|.
Human    73 ANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAA-----AGSFASAFAALVLCPTELVKC 132

  Fly   159 RLQLSTQVDSGIKFTGPIH----CLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLM-- 217
            |||...::::..|.....:    .:|.|::.:|..|.:.||::|:||::||:..:|..:|...  
Human   133 RLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSF 197

  Fly   218 ----RQVETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNE 278
                |..:..|....:::||..|:..|||.||:|.:|:.:|  .|..:.|..|||...:...:||
Human   198 FASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQ--VLSMSGKQAGFIRTFINVVKNE 260

  Fly   279 GPQYFFRGLNSTLIRAFPMNAACFFVVSW 307
            |....:.||..|:|||||.|.|.|....:
Human   261 GITALYSGLKPTMIRAFPANGALFLAYEY 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 30/95 (32%)
PTZ00169 41..295 CDD:240302 85/275 (31%)
Mito_carr 128..218 CDD:278578 27/99 (27%)
Mito_carr 221..304 CDD:278578 31/82 (38%)
SLC25A15NP_055067.1 Solcar 1 7..91 30/82 (37%)
Mito_carr 9..94 CDD:365909 30/85 (35%)
Solcar 2 104..197 29/97 (30%)
Mito_carr 122..198 CDD:365909 22/75 (29%)
Mito_carr 207..296 CDD:365909 31/85 (36%)
Solcar 3 207..293 31/85 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.