DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and slc25a47

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_004917228.1 Gene:slc25a47 / 100496270 XenbaseID:XB-GENE-6041480 Length:293 Species:Xenopus tropicalis


Alignment Length:294 Identity:113/294 - (38%)
Similarity:162/294 - (55%) Gaps:34/294 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VVDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPM 105
            :.||:||.||||.||:||:|.|||||.:||    ...|.|.:||.|:..:.::..|.::|:|.||
 Frog     1 MADFIAGALGGACGVMVGYPLDTVKVRIQT----QKNYNGIWHCVRSTYKMERVSGFFKGVSMPM 61

  Fly   106 GGIGLVNAIVFGVYGNVQR---------LSNDPNSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQ 161
            ..:.:.::||||||.||.|         .:..|:.. ..|.:|..||.||..|.:|.::||.|||
 Frog    62 SMVSVSSSIVFGVYRNVLRNLCKLKYGTTAVKPSKF-DIFLSGYAAGGAQILVSSPADMAKVRLQ 125

  Fly   162 L------STQVD--SGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSF----E 214
            .      ||...  :|.|::|||:||..|||.||..|.:||.:|.:.||...||:||:|:    |
 Frog   126 TQMCPPNSTTCSLLTGPKYSGPINCLLTIVKEEGFLGLYKGSSALMFRDCHSFATYFLSYAILRE 190

  Fly   215 YLM----RQVETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGF 275
            :|:    ...|..||   |.|||.||:.:|....|:||:|:.:|.|.: ...:|.|.|.|..:..
 Frog   191 WLLPFEQSHSELIGV---LFAGGFAGVVAWGIATPMDVIKSRLQVDGV-TKQRYRGVIHCITESV 251

  Fly   276 RNEGPQYFFRGLNSTLIRAFPMNAACFFVVSWVL 309
            |.||....|:||:...:||||:|...|.....:|
 Frog   252 RQEGITVLFKGLSLNCLRAFPVNMVVFLTYEAIL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 39/92 (42%)
PTZ00169 41..295 CDD:240302 107/278 (38%)
Mito_carr 128..218 CDD:278578 41/105 (39%)
Mito_carr 221..304 CDD:278578 32/82 (39%)
slc25a47XP_004917228.1 Mito_carr 1..84 CDD:395101 39/86 (45%)
Mito_carr 100..193 CDD:395101 39/92 (42%)
Mito_carr 198..286 CDD:395101 33/92 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X353
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.