DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and slc25a45

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_002662242.1 Gene:slc25a45 / 100329446 -ID:- Length:284 Species:Danio rerio


Alignment Length:284 Identity:110/284 - (38%)
Similarity:158/284 - (55%) Gaps:18/284 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPMG 106
            |:|:||.:.||.|::||||.|||||.|||..    .|.|...|......|:...|.::|:|.|:.
Zfish     4 VEFIAGWISGAVGLVVGHPLDTVKVRLQTQS----VYGGILDCVIKTYTREGLHGFFKGMSFPVL 64

  Fly   107 GIGLVNAIVFGVYGN-----VQRLSNDPNS---LTSHFFAGSIAGVAQGFVCAPMELAKTRLQLS 163
            .:.:.||:.||.|.|     .|...||.:.   |:..|.||..:|:||.||.||::|.|.|||..
Zfish    65 SVAVSNAVAFGSYSNALDYLTQSHHNDHSQRSPLSYVFMAGCFSGLAQLFVTAPIDLVKVRLQNQ 129

  Fly   164 TQVDS-GIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQV----ETP 223
            |:..| |.|:.||:||:..||:.:|::|.|:|..|..|||:|.:..||:.:|:.:|.:    :.|
Zfish   130 TRSRSAGNKYRGPLHCVAVIVREDGLKGLFRGFWALALRDVPCYGLYFLPYEFTLRMMTEKGKQP 194

  Fly   224 GVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNEGPQYFFRGLN 288
            |....|.|||.||:.:|....|:||||..:|... |....|:|.::|.....|.||.:.||:||.
Zfish   195 GHCAVLAAGGVAGVITWACATPMDVVKARLQMSG-GGGRVYSGVLNCITVSVREEGIRVFFKGLL 258

  Fly   289 STLIRAFPMNAACFFVVSWVLDIC 312
            ...:||||:||..|.....:|..|
Zfish   259 LNSVRAFPVNAVTFLSYEMILRAC 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 34/87 (39%)
PTZ00169 41..295 CDD:240302 102/265 (38%)
Mito_carr 128..218 CDD:278578 39/93 (42%)
Mito_carr 221..304 CDD:278578 33/82 (40%)
slc25a45XP_002662242.1 Mito_carr 2..85 CDD:278578 33/84 (39%)
Mito_carr 94..191 CDD:278578 39/96 (41%)
Mito_carr 200..280 CDD:278578 31/80 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8495
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X353
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.