DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and slc25a45

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_012816001.1 Gene:slc25a45 / 100127755 XenbaseID:XB-GENE-1006763 Length:332 Species:Xenopus tropicalis


Alignment Length:266 Identity:88/266 - (33%)
Similarity:133/266 - (50%) Gaps:29/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPMGGIGLVNAIVFGVYGN--------- 121
            |.|||..    :|:|...|.....:.:...|.::|:|.|:|.:.:.|::.||.|.|         
 Frog    70 VRLQTQS----RYRGILDCVIQTYRNETIFGFFKGMSFPVGSVAISNSLAFGSYSNALLYLSDQE 130

  Fly   122 VQRLSNDPNSLTSH-FFAGSIAGVAQGFVCAPMELAKTRLQLST-----QVDSG---IKFTGPIH 177
            ::...|.|::  .| |.||..:|:.|....||::|.|.|||..|     |...|   .::.||:|
 Frog   131 IKNWKNPPHN--CHVFMAGCFSGIVQLSFSAPVDLVKVRLQNQTESFGNQARPGHLQARYQGPVH 193

  Fly   178 CLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFE----YLMRQVETPGVAYTLMAGGCAGMS 238
            |...|.:.|||.|.::|..|..|||||....||:::|    ::.:.::.|.....|.||||||..
 Frog   194 CAVCIFREEGIFGLYRGCLALALRDIPSMGLYFLTYEVLCKWMTKSLDEPSAWTMLFAGGCAGTV 258

  Fly   239 SWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACFF 303
            .|....|:||:|..:|.|.: ...:|.|.:||..|..|.||.:.|.:||....:||||:||..|.
 Frog   259 GWAFANPMDVIKARLQMDGM-HGVQYLGMLDCIRKSIRQEGVKVFLKGLTINSLRAFPVNAVTFL 322

  Fly   304 VVSWVL 309
            ....:|
 Frog   323 SYEMLL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 17/67 (25%)
PTZ00169 41..295 CDD:240302 81/250 (32%)
Mito_carr 128..218 CDD:278578 36/102 (35%)
Mito_carr 221..304 CDD:278578 33/82 (40%)
slc25a45XP_012816001.1 Mito_carr <70..128 CDD:278578 17/61 (28%)
Mito_carr 144..240 CDD:278578 34/95 (36%)
Mito_carr 241..332 CDD:278578 34/89 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X353
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.