DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and slc25a15.2

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001090866.1 Gene:slc25a15.2 / 100038284 XenbaseID:XB-GENE-973185 Length:302 Species:Xenopus tropicalis


Alignment Length:301 Identity:97/301 - (32%)
Similarity:141/301 - (46%) Gaps:39/301 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPMG 106
            :|..||..||.|.||.|.||||.||.:||..   ..|:|...|.....::....|.|||.|..:.
 Frog    11 IDLTAGAAGGTACVLTGQPFDTAKVKMQTFP---TMYRGLMDCAVKTYRQMGLRGFYRGTSPALL 72

  Fly   107 GIGLVNAIVFGVYGNVQRLSN-----DPNSLTS---HFFAGSIAGVAQGFVCAPMELAKTRLQLS 163
            .....|:::|..||..|::..     |.|:..|   :..:||:|.:....|..|.||.|.|||..
 Frog    73 ANIAENSVLFMSYGFCQKVVRQIVGLDKNAELSDVQNAASGSVASIFAALVLCPTELVKCRLQAM 137

  Fly   164 TQVDSGIKFTGPI--------HCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLM--- 217
            .:    ::.:|.|        ..:|.||:.||....:.|||:||.|::||:..:|..:|...   
 Frog   138 HE----LQVSGKILQGQNTVWSVVKGIVQREGPLAFYNGLTSTICREMPGYFLFFGGYEASRSFF 198

  Fly   218 ----RQVETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNE 278
                :..:..|....:::||..|::.|||.||||.||:.:|  .|..:.|..||:...:...:||
 Frog   199 ASGGKSKDELGPMALIVSGGFGGIALWLAVYPIDCVKSRIQ--VLSISGKQAGFMKTFLHIVKNE 261

  Fly   279 GPQYFFRGLNSTLIRAFPMNAACFFVVSW-------VLDIC 312
            |....:.||..|||||||.|.|.|....:       .||.|
 Frog   262 GVLALYSGLKPTLIRAFPANGALFLAYEYSRRLMMNQLDCC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 30/82 (37%)
PTZ00169 41..295 CDD:240302 88/275 (32%)
Mito_carr 128..218 CDD:278578 31/107 (29%)
Mito_carr 221..304 CDD:278578 33/82 (40%)
slc25a15.2NP_001090866.1 Mito_carr 9..93 CDD:365909 30/84 (36%)
Mito_carr 104..198 CDD:365909 29/97 (30%)
Mito_carr 208..297 CDD:365909 33/90 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.