DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and slc25a47b

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001083050.1 Gene:slc25a47b / 100006442 ZFINID:ZDB-GENE-070424-85 Length:288 Species:Danio rerio


Alignment Length:280 Identity:107/280 - (38%)
Similarity:152/280 - (54%) Gaps:23/280 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VVDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPM 105
            :.||:||.:|||.||.||:|.|||||.|||    ...|.|.:.|.|...:.:...|.|||:|.|:
Zfish     3 LADFLAGSVGGAFGVAVGYPLDTVKVRLQT----QTGYSGFWQCVRKTCRNEGLQGFYRGMSMPI 63

  Fly   106 GGIGLVNAIVFGVYGNV--------QRLSNDPNSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQL 162
            ..:.:.:::|||.|.|:        .|.:.:|:.....|.||...||.|..|.||.::.|.|||.
Zfish    64 STVSISSSLVFGTYRNILQFLHQLQHRSAGEPHHKAHIFLAGFTGGVTQVLVMAPADIVKVRLQC 128

  Fly   163 STQ------VDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSF----EYLM 217
            .|:      .:|..|:.||:.||..|.:.||:.|.:||..|..|||.|.||:||:::    |.|.
Zfish   129 QTEPVQHISQESSSKYRGPVQCLLRIARDEGLLGLYKGSAALALRDGPSFATYFLTYNTICEILT 193

  Fly   218 RQVETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNEGPQY 282
            .:.:.||....|:|||.:||..|....|:||:|:.:|.|.: :..:|.||:.|.....|.||...
Zfish   194 TENQRPGWPVVLLAGGVSGMCGWAVGTPMDVIKSRLQVDGV-SGRRYRGFLHCITHSVRTEGSGV 257

  Fly   283 FFRGLNSTLIRAFPMNAACF 302
            .||||....|||||:|.:.|
Zfish   258 LFRGLTVNCIRAFPVNMSVF 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 35/91 (38%)
PTZ00169 41..295 CDD:240302 102/271 (38%)
Mito_carr 128..218 CDD:278578 38/99 (38%)
Mito_carr 221..304 CDD:278578 33/82 (40%)
slc25a47bNP_001083050.1 Solcar 1 1..83 35/83 (42%)
PTZ00169 3..288 CDD:240302 107/280 (38%)
Mito_carr 3..85 CDD:278578 35/85 (41%)
Solcar 2 99..191 35/91 (38%)
Mito_carr 102..196 CDD:278578 37/93 (40%)
Mito_carr 197..288 CDD:278578 33/82 (40%)
Solcar 3 199..286 33/80 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X353
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.