DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and si:dkey-150i13.2

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_001920218.1 Gene:si:dkey-150i13.2 / 100003928 ZFINID:ZDB-GENE-090312-157 Length:296 Species:Danio rerio


Alignment Length:271 Identity:99/271 - (36%)
Similarity:149/271 - (54%) Gaps:17/271 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPMGG 107
            :||||..||...:|.|||.||:||.|||.|  ...|||||.|||..|.::...|||:|:.:|:.|
Zfish    15 NFVAGGFGGICLLLAGHPLDTIKVRLQTQD--CAVYKGTFDCFRKTVSKEGIFGLYKGMGAPLAG 77

  Fly   108 IGLVNAIVFGVYG-NVQRLSNDPN---SLTSHFFAGSIAGVAQGFVCAPMELAKTRLQLSTQVDS 168
            :..:.|:.|..:| ..:.|..||.   :.|..:.||.:|||....:.||.|..|..||: ..:..
Zfish    78 VTPMMALNFFGFGLGKELLQRDPTVPATYTQIYLAGMLAGVCTTVIVAPGERIKCLLQI-LPLAG 141

  Fly   169 GIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQVETPG-------VA 226
            .:|:|||:.|...:.|.:||...:||...|::||:|....||::::||...:...|       .:
Zfish   142 RMKYTGPLDCAVRLYKQQGICSVYKGTILTLIRDVPSNGVYFLTYDYLKHYLTPDGECVHHLSTS 206

  Fly   227 YTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNEGPQYFFRGLNSTL 291
            ..|:|||.|||.:||...|.||:|::.|:   ..:.:|.|.........:.||.|..::|.::.:
Zfish   207 RVLLAGGIAGMINWLIALPADVLKSNYQS---ATDGRYQGVRHVLRTLLKEEGAQGLYKGFSAVM 268

  Fly   292 IRAFPMNAACF 302
            :||||.|||||
Zfish   269 LRAFPANAACF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 36/82 (44%)
PTZ00169 41..295 CDD:240302 91/262 (35%)
Mito_carr 128..218 CDD:278578 32/92 (35%)
Mito_carr 221..304 CDD:278578 30/89 (34%)
si:dkey-150i13.2XP_001920218.1 PTZ00169 6..272 CDD:240302 91/262 (35%)
Mito_carr 9..99 CDD:278578 37/85 (44%)
Mito_carr 103..197 CDD:278578 30/94 (32%)
Mito_carr 202..289 CDD:278578 29/81 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.