DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp14 and AT4G22350

DIOPT Version :9

Sequence 1:NP_001260321.1 Gene:Usp14 / 34387 FlyBaseID:FBgn0032216 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001190799.1 Gene:AT4G22350 / 828330 AraportID:AT4G22350 Length:539 Species:Arabidopsis thaliana


Alignment Length:386 Identity:89/386 - (23%)
Similarity:144/386 - (37%) Gaps:96/386 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LP--AGLTNLGNTCYMNATVQCLNAVPELRTALSTFSNDGTDTMSTAFSISSAMKSIF-AQMEKG 163
            ||  .||.|:..|.::|.|:|.|..|..||.......|................:.|: |:..||
plant   225 LPGMVGLNNIQKTEFVNVTIQSLMRVTPLRNFFLIPENYQHCKSPLGHRFGELTRKIWHARNFKG 289

  Fly   164 TTVTPIVLLQALHRASPQFAQTGENGTYRQQDANECWAEILKMLQQKLRPKNQEPSNTVQKRHSS 228
             .|:|...|||:.:||.:..:.|:     |.|..|..:.:|..|...||         ..|..||
plant   290 -QVSPHEFLQAVMKASKKRFRIGQ-----QSDPVEFMSWLLNTLHMDLR---------TSKDASS 339

  Fly   229 FIDQFFGGTFEVKMSSEEDPDEPSTVTSENFLQLSCFISMDVKYMQSGLKSKMKE----QLVKK- 288
            .|.:.|.|  |:::..|...:|...::...||.|...:.....:.....|:.:.:    .|:|| 
plant   340 IIHKCFQG--ELEVVKEYQGNENKEISRMPFLMLGLDLPPPPLFKDVMEKNIIPQVALFDLLKKF 402

  Fly   289 -SETLGRDAKYIR------TYLVSRLPAYLTVQFVRFQ----YKGKEGINAKVLKDIKFPIDFDA 342
             .||:   .:.:|      .|.|.:.|.||....|||:    :|.|   |..:   :.||:    
plant   403 DGETV---TEVVRPKLARMRYRVIKSPRYLMFHMVRFKKNNFFKEK---NPTL---VNFPV---- 454

  Fly   343 FELCTPELQNKLCPMRSKFKDLEDKKMEVDVVKRNEPNEEKKDVKYEQFWFDDDLGSNNSGYYTL 407
                               ||:|.:.....:.:..|                   |.|....|.|
plant   455 -------------------KDMELRDYIPSLPRAPE-------------------GENVCSKYNL 481

  Fly   408 QAVLTHKGRSSSSGHYVAWV-RSSGDVWFKFDDDEVSAVATDEILRLSGGGDWHCAYVLLY 467
            .|.:.|.|: ...|::..:| |.|.::|::..|..| |....:::.||.      ||:.:|
plant   482 IANIVHDGK-PEDGYFRVFVQRKSQELWYEMQDLHV-AETLPQMVELSE------AYMQIY 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp14NP_001260321.1 UBQ 4..73 CDD:214563
UBQ 5..73 CDD:294102
UCH 103..467 CDD:278850 87/383 (23%)
Peptidase_C19A 105..467 CDD:239122 86/379 (23%)
AT4G22350NP_001190799.1 Peptidase_C19M 110..535 CDD:239134 89/386 (23%)
UCH 229..534 CDD:278850 86/380 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.