DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp14 and Ublcp1

DIOPT Version :9

Sequence 1:NP_001260321.1 Gene:Usp14 / 34387 FlyBaseID:FBgn0032216 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_077795.2 Gene:Ublcp1 / 79560 MGIID:1933105 Length:318 Species:Mus musculus


Alignment Length:88 Identity:27/88 - (30%)
Similarity:49/88 - (55%) Gaps:6/88 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AFKVKVKWGRELYTDIVVNTDEEPILFKAQLFALTGVQPDRQKVM---CKGGILKDD--QWNLQI 62
            |..:.||||.:.|:...::.|:..:..|..|..||||.|:|||::   .||...::|  ...|::
Mouse     2 ALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKL 66

  Fly    63 KDGAVVLLLGSK-ESVPEVPATP 84
            |....::::|:: ||:.:|...|
Mouse    67 KPNTKIMMMGTREESLEDVLCPP 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp14NP_001260321.1 UBQ 4..73 CDD:214563 21/73 (29%)
UBQ 5..73 CDD:294102 21/72 (29%)
UCH 103..467 CDD:278850
Peptidase_C19A 105..467 CDD:239122
Ublcp1NP_077795.2 Ubl_UBLCP1 3..77 CDD:340511 21/73 (29%)
HAD_IIID1 117..311 CDD:131299
Phosphatase. /evidence=ECO:0000250 133..294
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1872
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.