DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp14 and Ublcp1

DIOPT Version :10

Sequence 1:NP_609377.1 Gene:Usp14 / 34387 FlyBaseID:FBgn0032216 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_077795.2 Gene:Ublcp1 / 79560 MGIID:1933105 Length:318 Species:Mus musculus


Alignment Length:88 Identity:27/88 - (30%)
Similarity:49/88 - (55%) Gaps:6/88 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AFKVKVKWGRELYTDIVVNTDEEPILFKAQLFALTGVQPDRQKVM---CKGGILKDD--QWNLQI 62
            |..:.||||.:.|:...::.|:..:..|..|..||||.|:|||::   .||...::|  ...|::
Mouse     2 ALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKL 66

  Fly    63 KDGAVVLLLGSK-ESVPEVPATP 84
            |....::::|:: ||:.:|...|
Mouse    67 KPNTKIMMMGTREESLEDVLCPP 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp14NP_609377.1 Ubl_USP14_like 4..75 CDD:340521 22/76 (29%)
Peptidase_C19A 105..467 CDD:239122
Ublcp1NP_077795.2 Ubl_UBLCP1 3..77 CDD:340511 21/73 (29%)
HAD_IIID1 117..311 CDD:131299
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.