DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp14 and ublcp1

DIOPT Version :9

Sequence 1:NP_001260321.1 Gene:Usp14 / 34387 FlyBaseID:FBgn0032216 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_021324596.1 Gene:ublcp1 / 792145 ZFINID:ZDB-GENE-040718-3 Length:371 Species:Danio rerio


Alignment Length:338 Identity:78/338 - (23%)
Similarity:133/338 - (39%) Gaps:92/338 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VKVKWGRELYTDIVVNT--DEEPIL-FKAQLFALTGVQPDRQKVMCKGGILK----DDQ---WNL 60
            |.:|||.:.|:   :||  :|:.:| .|..:.:||||.|:|||::  |..||    ||.   .:|
Zfish    58 VIIKWGGQEYS---INTLSEEDTVLDLKQSIKSLTGVLPERQKLL--GLKLKGKPADDNVKLGDL 117

  Fly    61 QIKDGAVVLLLGSK-ESVPEVPATP---------------VKFIEDMNEAEAATAMRL------- 102
            ::|....::::|:: ||:.:|.|.|               |..:|:..|..|..|.|:       
Zfish   118 KLKPNTKIMMMGTREESLEDVLAPPPENDDVVNDFDIEEEVTEVENREENLAKIARRVKDYKVEE 182

  Fly   103 -----PAG---LTNLGNTCYMNATVQCLNAVPEL-RTALSTFSNDGTDTMSTAFSISSAMKSIFA 158
                 |..   :.::..|.:.:.:  |.....|| |..|..|.....:........:::||.|.|
Zfish   183 LNPPRPGKRLLVLDIDYTLFDHKS--CAETGHELMRPFLHEFLTSAYEDFDIVIWSATSMKWIDA 245

  Fly   159 QM-EKGTTVTP---IVLLQALHRASPQFAQTGENGTYRQQDANECWAEILKMLQQKLRPKNQEPS 219
            :| |.|.|..|   |..:  |..|:.....|.:.|....:.....|.:..:...:|         
Zfish   246 KMKELGVTDNPNYKITFM--LDSAAMITVHTPKRGVVEVKPLGVIWGKYSEFYNRK--------- 299

  Fly   220 NTVQKRHSSFIDQFFGGTFEVKMSSEEDPDEPSTVTSENFLQLSCFISMDVKYMQSGLKSKMKEQ 284
            ||:.     |.|  .|..|              .:..:|.|::..|       |::.|..:..::
Zfish   300 NTIM-----FDD--IGRNF--------------LMNPQNGLKIRPF-------MKAHLNREKDKE 336

  Fly   285 LVKKSETLGRDAK 297
            |.|.|:.|...||
Zfish   337 LYKLSQYLKEIAK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp14NP_001260321.1 UBQ 4..73 CDD:214563 25/76 (33%)
UBQ 5..73 CDD:294102 25/76 (33%)
UCH 103..467 CDD:278850 41/203 (20%)
Peptidase_C19A 105..467 CDD:239122 40/201 (20%)
ublcp1XP_021324596.1 UBQ 59..130 CDD:320785 24/75 (32%)
HAD_IIID1 170..364 CDD:131299 43/221 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1872
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.