DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp14 and Usp8

DIOPT Version :9

Sequence 1:NP_001260321.1 Gene:Usp14 / 34387 FlyBaseID:FBgn0032216 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_650948.2 Gene:Usp8 / 42509 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster


Alignment Length:541 Identity:110/541 - (20%)
Similarity:178/541 - (32%) Gaps:220/541 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DRQKVMCKGGILKDDQWNLQIKDGAVVLLLGS------KESVPEVPATPVKFIEDM--------- 91
            :||::        |:|..|:.::...:|.:..      |...|..|.:|.:.:||:         
  Fly   451 ERQRL--------DEQHELERQERERLLAIARETKKHYKSPTPSGPPSPGRNLEDVHVVSDSLES 507

  Fly    92 --------------NEAEAAT---AMRLP---------------------------AGLTNLGNT 112
                          |:||..|   ||: |                           .||.|||||
  Fly   508 LLQLTGDPDPTIAPNKAEIPTFDRAMK-PQPRNVERTSQRVRDFSPVIGQNVGRGLTGLKNLGNT 571

  Fly   113 CYMNATVQCLNAVPELRTALSTFSNDGTDTMSTAFSISSAMKSIFAQMEK--GTTVTPI-VLLQA 174
            ||||:.:|||:..|:|                |.:.||...|:..::..|  |..:..: .|::.
  Fly   572 CYMNSILQCLSNTPQL----------------TEYCISDKYKNYISRSNKTNGQVIEEVAALIKE 620

  Fly   175 LHRASPQFAQTGENGTYR----------------------QQDANECWAEILKMLQQKLR----P 213
            |.           ||.|:                      |||::|....::..|...|:    |
  Fly   621 LW-----------NGQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILMDWLHSDLQTLHVP 674

  Fly   214 KNQEPSNTVQK--------RHSSFIDQFFGGTFEVKMSSEEDPDEPSTVTSENFLQLS------- 263
            :.:|..:..:|        :.|..:..|:|   ::|.:.:.......:.|.|:|..||       
  Fly   675 RQREMISASEKAWLEFTKAKESMILHLFYG---QMKSTVKCVACHKESATYESFSNLSLELPPNS 736

  Fly   264 --CFISMDVKYMQSGLK--------SKMKEQLVKKSETLGRDAKYIRTYLVSRLPAYLTVQFVRF 318
              |.::..:....||.:        .|.|...:||.:             :|:||..|.|...||
  Fly   737 NVCQLNQCMDMYFSGERIHGWNCPSCKTKRDAIKKLD-------------ISKLPPVLVVHLKRF 788

  Fly   319 QY-KGKEGINAKVLKDIKFPIDFDAFELCTPELQNKLCPMRSKFKDLEDKKMEVDVVKRNEPNEE 382
            .. ....|...|....::||                          ||:..|...:.:.......
  Fly   789 YADPSNSGSYMKKQNYLRFP--------------------------LENLDMNPYIARAESRAVT 827

  Fly   383 KKDVKYEQFWFDDDLGSNNSGYYTLQAVLTHKGRSSSSGHYVAWVRSSG-DVWFKFDDDEVSAVA 446
            .|.                   |.|.||..|.| :...|||.|:.:|:. ..||||||..|||:.
  Fly   828 PKT-------------------YQLYAVSNHYG-TMEGGHYTAFCKSANYGKWFKFDDQVVSALD 872

  Fly   447 TDEILRLSGGGDWHCAYVLLY 467
            :..::.       ..||:|.|
  Fly   873 SSNVVS-------SAAYILFY 886

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp14NP_001260321.1 UBQ 4..73 CDD:214563 6/30 (20%)
UBQ 5..73 CDD:294102 6/30 (20%)
UCH 103..467 CDD:278850 91/446 (20%)
Peptidase_C19A 105..467 CDD:239122 90/417 (22%)
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 90/419 (21%)
Peptidase_C19R 564..887 CDD:239139 91/419 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456851
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.