DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp14 and DUBAI

DIOPT Version :9

Sequence 1:NP_001260321.1 Gene:Usp14 / 34387 FlyBaseID:FBgn0032216 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_610784.1 Gene:DUBAI / 36361 FlyBaseID:FBgn0033738 Length:852 Species:Drosophila melanogaster


Alignment Length:470 Identity:102/470 - (21%)
Similarity:164/470 - (34%) Gaps:122/470 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LLLGSKESVPEVPATP--VKFIEDMNE-AEAATAMRLPAGLTNLGNTCYMNATVQCLNAVPELRT 130
            |.:.:|:::.....:|  |...:.|:| |:.........||.|||||||||:.:|.|....:...
  Fly   320 LYVATKKALQTYEPSPNCVALAKAMHENAQPWGRRNARVGLVNLGNTCYMNSVLQALAMTSDFSR 384

  Fly   131 ALSTFSNDGTDTMSTAFSISSAMKSIFAQMEKGTTVTPIVLLQALHRASPQFAQTGENGTYRQQD 195
            .:.....:....|.....|:....|:..::      ||..:|.|..  .|.|...      .|||
  Fly   385 QILLIECNSVLLMKVQQQIALMHHSLRYEL------TPSRVLNATR--PPSFTPG------LQQD 435

  Fly   196 ANECWAEILKMLQQKL-----------------RPKNQEPSNTVQKRHSSFIDQFFGGTFEVKMS 243
            ::|....:|.:|.:..                 |..:..|:...:...||.:..:.....|:...
  Fly   436 SSEFLGYLLDLLHEHEINSSSVTGHSVGPPKTGREVDDVPALLSEDILSSGVIPYNSKDHELSSG 500

  Fly   244 SEED-------PDEPSTVTSENFLQLSCFISMDVKYMQSGLKSKMKE-QLVKKSETLGRD--AKY 298
            |..|       |..|:|.|...                :|||.:.:: ...|...|:.:.  .|.
  Fly   501 SNSDNCNHKPTPTPPATPTKAT----------------NGLKQQGQQVDQAKPPSTIDKTFAGKL 549

  Fly   299 IRTYLVSRLPAYLTVQFVRFQYKGKEGINAKVLKDIK--FPID-----------FDAFE-LCTPE 349
            ..||              |....|.|..|....::::  ||.|           .|..| .|:||
  Fly   550 STTY--------------RCLNCGWESRNEDSFRELQLSFPDDKEDCGATNYSVQDLIEYYCSPE 600

  Fly   350 LQNKL-------CPMRSKFKDLEDKKMEVDVVKRN---EPNEEKKDVKY-------EQFWFD--- 394
               ||       ||...|..|.| :.:.|....:|   ...:.|.|.||       .:.:.|   
  Fly   601 ---KLDGDNQYFCPQCKKLCDAE-RHIGVTQAPKNLILTLKQFKYDQKYHFRTKLMHKVFHDESV 661

  Fly   395 -------DDLGSNNSGYYTLQAVLTHKGRSSSSGHYVAWVRSSGDVWFKFDDDEVSAVATDEILR 452
                   |.|...::.:|.|.|.:.|.|.|..||||..:.......|:||:|:.|:....:|:..
  Fly   662 TVKMSAKDSLQEMSTVHYDLYAGVVHAGYSMDSGHYFTFAADQAKNWYKFNDNVVTHSKPEEMHN 726

  Fly   453 LSGGGDWHCAYVLLY 467
            |:..   :..|:|.|
  Fly   727 LTSP---NTPYILFY 738

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp14NP_001260321.1 UBQ 4..73 CDD:214563 1/3 (33%)
UBQ 5..73 CDD:294102 1/3 (33%)
UCH 103..467 CDD:278850 94/431 (22%)
Peptidase_C19A 105..467 CDD:239122 94/429 (22%)
DUBAINP_610784.1 UCH 358..738 CDD:278850 94/430 (22%)
Peptidase_C19H 359..739 CDD:239129 95/431 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456877
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.