DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp14 and Ublcp1

DIOPT Version :10

Sequence 1:NP_609377.1 Gene:Usp14 / 34387 FlyBaseID:FBgn0032216 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001014139.1 Gene:Ublcp1 / 360514 RGDID:1310386 Length:318 Species:Rattus norvegicus


Alignment Length:83 Identity:26/83 - (31%)
Similarity:47/83 - (56%) Gaps:6/83 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKWGRELYTDIVVNTDEEPILFKAQLFALTGVQPDRQKVM---CKGGILKDD--QWNLQIKDGAV 67
            ||||.:.|:...::.|:..:..|..|..||||.|:|||::   .||...::|  ...|::|....
  Rat     7 VKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTK 71

  Fly    68 VLLLGSK-ESVPEVPATP 84
            ::::|:: ||:.:|...|
  Rat    72 IMMMGTREESLEDVLCPP 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp14NP_609377.1 Ubl_USP14_like 4..75 CDD:340521 22/72 (31%)
Peptidase_C19A 105..467 CDD:239122
Ublcp1NP_001014139.1 Ubl_UBLCP1 3..77 CDD:340511 21/69 (30%)
HAD_IIID1 117..311 CDD:131299
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.