DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp14 and Usp2

DIOPT Version :9

Sequence 1:NP_001260321.1 Gene:Usp14 / 34387 FlyBaseID:FBgn0032216 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001285528.1 Gene:Usp2 / 33132 FlyBaseID:FBgn0031187 Length:950 Species:Drosophila melanogaster


Alignment Length:400 Identity:94/400 - (23%)
Similarity:153/400 - (38%) Gaps:115/400 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GLTNLGNTCYMNATVQCLNAVPELRTALSTFSNDGTDTMSTAFSISSAMKSIFAQM--EKGT--- 164
            ||.|:||||:||:.:|||:...||...|.  |:.|:.::||.   ...:...||::  |..|   
  Fly   626 GLRNIGNTCFMNSVIQCLSHTQELTRFLR--SHHGSRSLSTK---DQQILHEFAKLIQEMWTANV 685

  Fly   165 -TVTPIVLLQALHRASPQFAQTGENGTYRQQDANECWAEILKMLQQKLR--------------PK 214
             ||||:.|.:|.......::.      |.||||.|.....|..|...|.              ..
  Fly   686 HTVTPMELKRAFSTKHRMYSD------YNQQDAQEFLRFFLDSLHSALNSGVKGETLNIDDNLSD 744

  Fly   215 NQEPSNTVQ--KRH-SSFIDQFFGGTFEVKMSSEEDPDEPSTVTSENFLQLSCFISMDVKYMQSG 276
            |::...|.:  .|| :|.:...|.|  ::|.:.:......::||.:.|..||.       .:.|.
  Fly   745 NKKADLTWEWYTRHENSLVRDLFVG--QLKSTLKCTTCGNTSVTFDPFWDLSV-------PLPSS 800

  Fly   277 LKSKMKE--QLVKKSETLGRD-----------AKYIRTYLVSRLPAYLTVQFVRFQYKGKEGINA 328
            .:.|::.  .|..:.|.|..|           .|..:::.:.|.|.||.:...||    .|...:
  Fly   801 SRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKRF----SETRWS 861

  Fly   329 KVLKDIKFPIDFDAFELCTPELQNKLCPMRSKFKDLEDKKMEVDVVKRNEPNEEKKDVKYEQFWF 393
            |:...::||                          ..|.::.:.....|                
  Fly   862 KLSNIVEFP--------------------------TSDSELNMGSYGAN---------------- 884

  Fly   394 DDDLGSNNSGYYTLQAVLTHKGRSSSSGHYVAWVRSS-GDVWFKFDDDEVSAVATDEILRLSGGG 457
                 ||::.:|:|.|:..|.| |::.|||||..:.. ...|.:|:|:.||...::..|..|.  
  Fly   885 -----SNSNVHYSLYAISNHMG-STAGGHYVALCKHPVSRKWHEFNDNIVSDALSENHLVSSS-- 941

  Fly   458 DWHCAYVLLY 467
                ||:|.|
  Fly   942 ----AYILFY 947

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp14NP_001260321.1 UBQ 4..73 CDD:214563
UBQ 5..73 CDD:294102
UCH 103..467 CDD:278850 93/398 (23%)
Peptidase_C19A 105..467 CDD:239122 93/398 (23%)
Usp2NP_001285528.1 UCH 624..947 CDD:278850 93/398 (23%)
Peptidase_C19R 626..948 CDD:239139 93/399 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456907
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.