DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp14 and Ubfd1

DIOPT Version :9

Sequence 1:NP_001260321.1 Gene:Usp14 / 34387 FlyBaseID:FBgn0032216 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_006230251.1 Gene:Ubfd1 / 293454 RGDID:1306614 Length:354 Species:Rattus norvegicus


Alignment Length:295 Identity:63/295 - (21%)
Similarity:105/295 - (35%) Gaps:93/295 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VKVKWGRELYTDIVVNTDEEPILFKAQLFALTGVQPDRQKVMCKGGILKDDQWNLQIK--DGAVV 68
            :|:.|.:..: |:.|..|......|.::.::||:.|..||||.| |::.:|:...:||  .||.:
  Rat   147 LKIIWNKTKH-DVKVPLDSTGSELKQKIHSITGLPPAMQKVMYK-GLVPEDKTLREIKVTSGAKI 209

  Fly    69 LLLGSKESVPEVPATPVKFIEDMNEAEAATAMRLPAGLTNLGNTCYMNATVQCLN-AVPELRTAL 132
            :::||  ::.:|.|..........:|:|..:.:.|        .|......:.|: ..||     
  Rat   210 MVVGS--T
INDVLAVNTPKDAAQQDAKAEESKKEP--------LCRQKQHRKVLDKGKPE----- 259

  Fly   133 STFSNDGTDTMSTAFSISSAMKSIFAQMEKGTTVTPIVLLQALHRASPQFAQTGENGTYRQQDAN 197
                    |.|.   |:..|.:.:           |.|.|..::..|        .|..|     
  Rat   260 --------DVMP---SVKGAQERL-----------PTVPLSGMYNKS--------GGKVR----- 289

  Fly   198 ECWAEILKMLQQKLRPKNQEPSNTVQKRHSSFIDQFFGGTFEVKMSSEEDPDEPSTVTSENFLQL 262
                     |..||..                 ||.:.||    ..|..||:.|::..|....:.
  Rat   290 ---------LTFKLEQ-----------------DQLWIGT----KDSWRDPNMPNSPVSGQHCRY 324

  Fly   263 SCFISMDVKYMQSGLKSKMKEQLVKKSETLGRDAK 297
            |.|        :|||::.....|...|..|.:|.|
  Rat   325 SVF--------ESGLRNCPWAPLKMLSVNLLKDMK 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp14NP_001260321.1 UBQ 4..73 CDD:214563 20/68 (29%)
UBQ 5..73 CDD:294102 20/68 (29%)
UCH 103..467 CDD:278850 37/196 (19%)
Peptidase_C19A 105..467 CDD:239122 36/194 (19%)
Ubfd1XP_006230251.1 UBQ 145..214 CDD:214563 20/68 (29%)
ubiquitin 148..215 CDD:278661 22/70 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1872
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.