DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk5alpha and Cdk5r2

DIOPT Version :9

Sequence 1:NP_001260320.1 Gene:Cdk5alpha / 34385 FlyBaseID:FBgn0027491 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001102779.1 Gene:Cdk5r2 / 501164 RGDID:1562530 Length:368 Species:Rattus norvegicus


Alignment Length:350 Identity:127/350 - (36%)
Similarity:169/350 - (48%) Gaps:89/350 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 EKNLKKHSIFINALSWKKLSTSHNKKKIENKNKCANLPTACFKAQLLESSFASSSDKNRNIQLHC 194
            |..||:.|:.|:||:||:|..:..||| :...|....|             ||:.          
  Rat    51 ESRLKRPSVLISALTWKRLVAASAKKK-KGSKKVTPKP-------------ASTG---------- 91

  Fly   195 NRIDEHNQQHCNQHPHPHPHQHQLQLQNQHQHQNQNQNQNQNQVQDIREEVMT------------ 247
                            |.|...|...:|. ..:.::........:.:...|.|            
  Rat    92 ----------------PDPLVQQRNRENL-LRKGRDAPDGGGAAKPLAVPVPTVPASAATCEPPS 139

  Fly   248 ------GPPGKSQNPSKAKDPVKVNNKNSMSNHNKLIQKQPLTLSLPQQVQASSIQTKNTNQIPR 306
                  .|||..........|                   |...:.|.....|          ||
  Rat   140 GGSAAAPPPGSGGGKPPPPPP-------------------PAPQAAPPAPGGS----------PR 175

  Fly   307 KTVIQASTSELLKCLGMFLHCRCQRLNNFDAGDAVMWLRAVDRSLLLQGWQDVAFINPANVVFVY 371
            :.::||||.|||:|||.|:..||.||.....|:.|.|.|.||||||||||||.|||.|||:||||
  Rat   176 RVIVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVY 240

  Fly   372 MLVRELVSGEE-SKESDLQASVLTCLYLSYSYMGNEISYPLKPFLVEDSKEKFWDRCLVIVNKLS 435
            :|.||.:.|:| :..::|||:.||||||:||||||||||||||||||..||:||.|||.::.:||
  Rat   241 LLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLS 305

  Fly   436 DKMLKINAEPGFFTEVFTELKSCGQ 460
            .:||::||:|.|||:||.:||:.|:
  Rat   306 PQMLRLNADPHFFTQVFQDLKNEGE 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk5alphaNP_001260320.1 CDK5_activator 107..458 CDD:281279 126/346 (36%)
Cdk5r2NP_001102779.1 CDK5_activator <174..329 CDD:397388 96/154 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351397
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3932
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I3298
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492547at2759
OrthoFinder 1 1.000 - - FOG0001633
OrthoInspector 1 1.000 - - otm44881
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23401
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1362
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.