DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk5alpha and cdk5r1

DIOPT Version :9

Sequence 1:NP_001260320.1 Gene:Cdk5alpha / 34385 FlyBaseID:FBgn0027491 Length:472 Species:Drosophila melanogaster
Sequence 2:XP_002935561.1 Gene:cdk5r1 / 100497533 XenbaseID:XB-GENE-1032903 Length:292 Species:Xenopus tropicalis


Alignment Length:339 Identity:134/339 - (39%)
Similarity:179/339 - (52%) Gaps:95/339 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 EKSSFEKNLKKHSIFINALSWKKLSTSHNKKKIENKNKCANLPTACFKAQLLESSFASSSDKNRN 189
            :.|...|:||:||| |:.|.||:|....:||:...|.:                  |:.|.:|  
 Frog    31 QNSKNGKSLKRHSI-ISVLPWKRLVAVSSKKRQPKKGQ------------------ANGSYQN-- 74

  Fly   190 IQLHCNRIDEHNQQHCNQHPHPHPHQHQLQLQNQHQHQNQNQNQNQNQVQDIREEVMTGPPGKSQ 254
                       |..|.|                                              |:
 Frog    75 -----------NITHLN----------------------------------------------SE 82

  Fly   255 NPSKAKDPVKVNNKNSMSNHNK-LIQK---QPLTLSLPQQVQASSIQTKNTNQIPRKTVIQASTS 315
            |..|:   :...|.:|.:...| .:.|   ..:|.:..||:.||          |::.|:|||||
 Frog    83 NLKKS---ISCANLSSFTQDTKDSLSKGVGASITKAAGQQIHAS----------PKRVVVQASTS 134

  Fly   316 ELLKCLGMFLHCRCQRLNNFDAGDAVMWLRAVDRSLLLQGWQDVAFINPANVVFVYMLVRELVSG 380
            |||:|||.||..||.:|.:....:.|:|||:||||||||||||..||.|||:||:|||.|:.:|.
 Frog   135 ELLRCLGEFLCRRCYKLKHLSPTEPVLWLRSVDRSLLLQGWQDQGFITPANIVFLYMLCRDTISS 199

  Fly   381 EESKESDLQASVLTCLYLSYSYMGNEISYPLKPFLVEDSKEKFWDRCLVIVNKLSDKMLKINAEP 445
            |.:.|.||||::|||:|||||||||||||||||||||:|||.||||||.|:..:|.|||:|||:|
 Frog   200 ELNTEQDLQAALLTCVYLSYSYMGNEISYPLKPFLVENSKEDFWDRCLSIITMMSAKMLRINADP 264

  Fly   446 GFFTEVFTELKSCG 459
            .:||::|.:|||.|
 Frog   265 QYFTQIFADLKSEG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk5alphaNP_001260320.1 CDK5_activator 107..458 CDD:281279 132/336 (39%)
cdk5r1XP_002935561.1 CDK5_activator 29..279 CDD:367424 134/339 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2554
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 260 1.000 Inparanoid score I3029
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492547at2759
OrthoFinder 1 1.000 - - FOG0001633
OrthoInspector 1 1.000 - - otm47923
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3652
SonicParanoid 1 1.000 - - X1362
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.