DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Tmprss5

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001346389.1 Gene:Tmprss5 / 80893 MGIID:1933407 Length:455 Species:Mus musculus


Alignment Length:334 Identity:92/334 - (27%)
Similarity:154/334 - (46%) Gaps:54/334 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LCANDTINTSGDGIIDIRLGTDAECKNYLDLCCDLPNKRKDPIFE--FKP--DHPEG------CG 136
            |..:..:|.|     ||:|....|   :..|     :.|...:.|  :||  :.|.|      |.
Mouse   156 LTQHKAVNLS-----DIKLNRSQE---FAQL-----SARPGGLVEESWKPSANCPSGRIVSLKCS 207

  Fly   137 YQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHN---K 198
            ......:..:|.|  .|....|.:||..:::..    :.:.||.:::||:.|:|||||:::   .
Mouse   208 ECGARPLASRIVG--GQAVASGRWPWQASVMLG----SRHTCGASVLAPHWVVTAAHCMYSFRLS 266

  Fly   199 QPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVC 263
            :.||..|.||   ..:...:|:|:...|::||.|..::..:...|||::.|.:|....:.:..||
Mouse   267 RLSSWRVHAG---LVSHGAVRQHQGTMVEKIIPHPLYSAQNHDYDVALLQLRTPINFSDTVGAVC 328

  Fly   264 LPNVGDKFDF-DRCYATGWG----KNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFI 323
            ||.....|.: .:|:.:|||    .:....|     .|:...:|::....|.::...:....|.:
Mouse   329 LPAKEQHFPWGSQCWVSGWGHTDPSHTHSSD-----TLQDTMVPLLSTYLCNSSCMYSGALTHRM 388

  Fly   324 LHDSFICAGG-EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLR 387
            |     |||. :...|.|:||.|.|||||   ..:.:...|:|:||.||.|.|.|||||.||:..
Mouse   389 L-----CAGYLDGRADACQGDSGGPLVCP---SGDTWHLVGVVSWGRGCAEPNRPGVYAKVAEFL 445

  Fly   388 PWIDAKLKI 396
            .||...:::
Mouse   446 DWIHDTVQV 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 74/246 (30%)
Tryp_SPc 153..390 CDD:214473 73/245 (30%)
Tmprss5NP_001346389.1 SRCR_2 116..213 CDD:317845 15/69 (22%)
Tryp_SPc 217..448 CDD:214473 75/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.