DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Prss8

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:252 Identity:79/252 - (31%)
Similarity:125/252 - (49%) Gaps:21/252 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCV---HNKQPSSIVVRA 207
            :|||  ...|:.|::||.::| ..:||   :.|||:|::...|::||||.   |:::...:.:.|
Mouse    44 RITG--GGSAKPGQWPWQVSI-TYDGN---HVCGGSLVSNKWVVSAAHCFPREHSREAYEVKLGA 102

  Fly   208 GEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFD 272
            .:.|:.:...:    ...|.:||.|..:.:.....|:|::.|.||.|....|:.:|||.....|.
Mouse   103 HQLDSYSNDTV----VHTVAQIITHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPAANASFP 163

  Fly   273 FD-RCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCET--NLRETRLGRHFILHDSFICAGGE 334
            .. .|..||||........:....|:::::|::..:.|..  |:.......|.|..| .:|||..
Mouse   164 NGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQD-MLCAGYV 227

  Fly   335 K-DKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            | .||.|:||.|.||.||:.|   .:..||||:||..||..|.||||...:....||
Mouse   228 KGGKDACQGDSGGPLSCPMEG---IWYLAGIVSWGDACGAPNRPGVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 76/245 (31%)
Tryp_SPc 153..390 CDD:214473 74/243 (30%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 79/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.