DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and XB5723326

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001037931.1 Gene:XB5723326 / 733551 XenbaseID:XB-GENE-5723327 Length:349 Species:Xenopus tropicalis


Alignment Length:256 Identity:73/256 - (28%)
Similarity:119/256 - (46%) Gaps:41/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 GEFPWMLAILR--EEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEI-- 218
            |::||:::|.:  |.|..::  |.|.::....::|||||..:.:         |.|..|...:  
 Frog    25 GKWPWIVSIQKKVELGYKHI--CAGTILNNEWIITAAHCFKDWK---------EGDPTTPLRVLL 78

  Fly   219 ---------RRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLP-NVGDKFDF 273
                     .|.:.|.||::|.|:|::..:..||:|::.|:......::||..|.| ...|..|.
 Frog    79 GTFYLSEIGLRTQSRGVKQLIKHDQYDPITESNDIALIQLDKQVEFSDHIQQACFPKESADLKDL 143

  Fly   274 DRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHF---ILHDSFICAGGEK 335
            ..|...|||...           |.:|.|....|:.:....:|:....:   ||.::.:|||..|
 Frog   144 IDCSIAGWGAQG-----------KHLDEPSQFLQEAQVERIDTKHCNKWYQGILGENHLCAGHRK 197

  Fly   336 DKD-TCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWIDAKLK 395
            ..: ||.||.||||:|. ..:.|.:...||:.||.|||:...||||:.:.....||..|:|
 Frog   198 GPEKTCNGDRGSPLMCR-TKKNNVYSVIGILNWGSGCGQTRSPGVYSPIQSHIKWIVEKVK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 70/250 (28%)
Tryp_SPc 153..390 CDD:214473 69/249 (28%)
XB5723326NP_001037931.1 Tryp_SPc 25..252 CDD:214473 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.