DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Prss22

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:270 Identity:78/270 - (28%)
Similarity:133/270 - (49%) Gaps:31/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PDHPEGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAH 193
            ||    ||  .|..:...:.|..:.:|   ::||:::||:.    ..:.|.|:|:....|:||||
Mouse    97 PD----CG--KPQQLNRIVGGEDSMDA---QWPWIVSILKN----GSHHCAGSLLTNRWVVTAAH 148

  Fly   194 CVHNK--QPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFN-KGSLYNDVAVMLLESPFTL 255
            |..:.  :||...|..|.|...:...  |.:...:..::.|.::: |...:.|:|::.||.....
Mouse   149 CFKSNMDKPSLFSVLLGAWKLGSPGP--RSQKVGIAWVLPHPRYSWKEGTHADIALVRLEHSIQF 211

  Fly   256 QENIQTVCLPN----VGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRET 316
            .|.|..:|||:    :..|.|   |:..|||..:.|....:...|:|:.:|::..:.|: :|...
Mouse   212 SERILPICLPDSSVRLPPKTD---CWIAGWGSIQDGVPLPHPQTLQKLKVPIIDSELCK-SLYWR 272

  Fly   317 RLGRHFILHDSFICAGG-EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVY 380
            ..|:..|. :..:|||. |.::|.|.||.|.||:|.:   .:.:...||::||.||.|.|.||||
Mouse   273 GAGQEAIT-EGMLCAGYLEGERDACLGDSGGPLMCQV---DDHWLLTGIISWGEGCAERNRPGVY 333

  Fly   381 ASVAKLRPWI 390
            .|:...|.|:
Mouse   334 TSLLAHRSWV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 72/246 (29%)
Tryp_SPc 153..390 CDD:214473 71/244 (29%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.