DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and LOC683849

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:255 Identity:81/255 - (31%)
Similarity:124/255 - (48%) Gaps:46/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KITGAVN-QEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGE 209
            ||.|... ||   ...|:.:::     |...:.|||:||....|::||||    ..|.|.||.||
  Rat    23 KIVGGYTCQE---NSVPYQVSL-----NSGYHFCGGSLINDQWVVSAAHC----YKSRIQVRLGE 75

  Fly   210 WDTQTQTEIRRHEDRYVK--EIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPN----VG 268
            .:    ..:....:::|.  :||.|..|::.:|.||:.::.|.||..|...:.||.||:    .|
  Rat    76 HN----INVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAG 136

  Fly   269 DKFDFDRCYATGWGKN-KFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAG 332
                 .:|..:|||.. .||.:  ...:|:.:|.|::|:..||.:..    |:   :.|:.:|||
  Rat   137 -----TQCLISGWGNTLSFGVN--EPDLLQCLDAPLLPQADCEASYP----GK---ITDNMVCAG 187

  Fly   333 G-EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWID 391
            . |..||:|:||.|.|:||       ..:..|||:||.||...:.||||..|.....||:
  Rat   188 FLEGGKDSCQGDSGGPVVC-------NGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 77/245 (31%)
Tryp_SPc 153..390 CDD:214473 76/244 (31%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 79/252 (31%)
Tryp_SPc 24..242 CDD:238113 80/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.