DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Prss47

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_038952282.1 Gene:Prss47 / 680378 RGDID:1592951 Length:398 Species:Rattus norvegicus


Alignment Length:320 Identity:87/320 - (27%)
Similarity:131/320 - (40%) Gaps:63/320 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LPNKRKDPIFEFKPDHPEG-------------------CGYQNPNGVGFKITGAVNQEAEFGEFP 161
            :|:..|.|  |..|..|:.                   ||  .|..|| |:.|  .|:...|::|
  Rat    38 IPSPSKVP--EIAPGRPQPQQGWEPSASRNQDPVTRPVCG--KPKMVG-KVFG--GQDTLAGQWP 95

  Fly   162 WMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ--PSSIVVRAGEWDTQTQTEIRRHEDR 224
            |..::|..    .|:.||..||..:.:::.|||..||.  |....|..|......:|   :|..:
  Rat    96 WQASLLYR----GLHLCGAVLIDSHWLVSTAHCFRNKSQAPEDYEVLLGNNQLYQKT---KHTQK 153

  Fly   225 Y-VKEIIYHEQFNK-GSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKF-DFDRCYATGWG---- 282
            . |..||.|..|.| .|..:|:|::.|..|......:...|||:...:. :...|:.||||    
  Rat   154 IPVNHIINHPDFEKFHSFGSDIAMLQLRLPVNFTSYVVPACLPSKDTQLSNHTSCWITGWGMLSE 218

  Fly   283 --KNK---FGKDGEYQVILKKVDMPVVPEQQCETNLRET---------RLG--RHFILHDSFICA 331
              |.|   .|..|..:..::...:|....|:.|..:.|.         |||  |::: |:..:||
  Rat   219 DSKGKRSWRGSKGREKRKIRAKLLPPFSLQEGEVGIIENEFCNALYGQRLGQSRNYV-HEEMLCA 282

  Fly   332 GG-EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            || ...|..|:||.|.||||   ...:.:...|:.:||:.|.....|.|:..|.....||
  Rat   283 GGLSTGKSICRGDSGGPLVC---YHISAWVLVGLASWGLDCRPSIYPSVFTRVTYFTDWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 74/264 (28%)
Tryp_SPc 153..390 CDD:214473 72/262 (27%)
Prss47XP_038952282.1 Tryp_SPc 83..342 CDD:238113 75/270 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.