DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and zgc:123295

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:249 Identity:79/249 - (31%)
Similarity:133/249 - (53%) Gaps:23/249 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEW 210
            ||.|  .|.|..|.:||.:::  :......:.|||:||..:.||:||||..: ...:|:|:.|  
Zfish    35 KIVG--GQNAGAGSWPWQVSL--QSPTYGGHFCGGSLINKDWVLSAAHCFQD-SIGTIMVKLG-- 92

  Fly   211 DTQTQTEIRRHE-DRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFD 274
             .|:|:....:: .:.|.::|.|..:|..|..||:|::.|:|..|..:.|:.|||...|:.:...
Zfish    93 -LQSQSGSNPYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTYAAG 156

  Fly   275 R-CYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAG--GEKD 336
            . .:.|||||.....: :...||::|::|:|....|    :....|.   :..:.||||  .:..
Zfish   157 TLSWVTGWGKLSSAAN-QIPDILQEVEIPIVSHSDC----KRAYPGE---ITSNMICAGLLDQGG 213

  Fly   337 KDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            ||:|:||.|.|:|   :...:::..:|||::|.||.|...|||||.|::.:.||
Zfish   214 KDSCQGDSGGPMV---SRNGSQWIQSGIVSFGRGCAEPGYPGVYARVSQYQDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 76/242 (31%)
Tryp_SPc 153..390 CDD:214473 74/240 (31%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 77/247 (31%)
Tryp_SPc 36..264 CDD:238113 76/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587344
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.